BLASTX nr result
ID: Mentha28_contig00010644
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha28_contig00010644 (340 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EYU32055.1| hypothetical protein MIMGU_mgv1a012957mg [Mimulus... 89 6e-16 ref|XP_002273596.1| PREDICTED: peroxisomal membrane protein 11C ... 89 6e-16 gb|AAK59793.1| At2g45740/F4I18.28 [Arabidopsis thaliana] gi|1632... 88 1e-15 ref|NP_566055.1| peroxisomal membrane protein 11D [Arabidopsis t... 88 1e-15 ref|XP_007051927.1| Peroxin 11c isoform 1 [Theobroma cacao] gi|5... 88 1e-15 ref|XP_006339470.1| PREDICTED: peroxisomal membrane protein 11C-... 87 2e-15 ref|XP_004229845.1| PREDICTED: peroxisomal membrane protein 11C-... 87 2e-15 ref|XP_002511795.1| peroxisomal biogenesis factor, putative [Ric... 87 3e-15 ref|XP_006294921.1| hypothetical protein CARUB_v10023974mg [Caps... 86 4e-15 gb|EXB44728.1| Peroxisomal membrane protein 11C [Morus notabilis] 86 5e-15 ref|XP_004133885.1| PREDICTED: peroxisomal membrane protein 11D-... 86 5e-15 ref|XP_002880194.1| peroxisomal biogenesis factor 11 family prot... 86 5e-15 gb|EYU35059.1| hypothetical protein MIMGU_mgv1a012938mg [Mimulus... 85 9e-15 ref|XP_006341731.1| PREDICTED: peroxisomal membrane protein 11C-... 85 1e-14 ref|XP_002889352.1| peroxisomal biogenesis factor 11 family prot... 84 2e-14 ref|XP_002320762.1| peroxisomal biogenesis factor 11 family prot... 84 2e-14 ref|XP_006386590.1| hypothetical protein POPTR_0002s15510g [Popu... 84 2e-14 ref|XP_002301325.1| peroxisomal biogenesis factor 11 family prot... 84 2e-14 ref|XP_006445153.1| hypothetical protein CICLE_v10022007mg [Citr... 84 3e-14 ref|XP_006418462.1| hypothetical protein EUTSA_v10008643mg [Eutr... 84 3e-14 >gb|EYU32055.1| hypothetical protein MIMGU_mgv1a012957mg [Mimulus guttatus] gi|604321480|gb|EYU32056.1| hypothetical protein MIMGU_mgv1a012957mg [Mimulus guttatus] Length = 235 Score = 89.0 bits (219), Expect = 6e-16 Identities = 44/54 (81%), Positives = 48/54 (88%) Frame = -1 Query: 340 SLALVKAVLDLGVCCGLLQLAPTKITPRVTGAFGFVTSVISCYQLLPSPPKTKT 179 ++ALVKA LDL V GLLQLAP KITPRVTGAFGF +S+ISCYQLLPSPPKTKT Sbjct: 181 TIALVKAGLDLVVAVGLLQLAPKKITPRVTGAFGFTSSLISCYQLLPSPPKTKT 234 >ref|XP_002273596.1| PREDICTED: peroxisomal membrane protein 11C isoform 2 [Vitis vinifera] gi|225453746|ref|XP_002273544.1| PREDICTED: peroxisomal membrane protein 11C isoform 1 [Vitis vinifera] gi|296089071|emb|CBI38774.3| unnamed protein product [Vitis vinifera] Length = 235 Score = 89.0 bits (219), Expect = 6e-16 Identities = 43/54 (79%), Positives = 48/54 (88%) Frame = -1 Query: 340 SLALVKAVLDLGVCCGLLQLAPTKITPRVTGAFGFVTSVISCYQLLPSPPKTKT 179 SLALVKAV+D V GLLQLAP K+TPRVTG FGFV+S+ISCYQLLPSPPK+KT Sbjct: 181 SLALVKAVMDTVVAVGLLQLAPKKVTPRVTGGFGFVSSLISCYQLLPSPPKSKT 234 >gb|AAK59793.1| At2g45740/F4I18.28 [Arabidopsis thaliana] gi|16323256|gb|AAL15362.1| At2g45740/F4I18.28 [Arabidopsis thaliana] Length = 105 Score = 88.2 bits (217), Expect = 1e-15 Identities = 41/54 (75%), Positives = 48/54 (88%) Frame = -1 Query: 340 SLALVKAVLDLGVCCGLLQLAPTKITPRVTGAFGFVTSVISCYQLLPSPPKTKT 179 SLAL+K+ +D+ V GLLQLAPTKITPRVTGAFGF+TS+ISCYQLLP+ PK KT Sbjct: 51 SLALIKSAMDIVVAAGLLQLAPTKITPRVTGAFGFITSIISCYQLLPTRPKIKT 104 >ref|NP_566055.1| peroxisomal membrane protein 11D [Arabidopsis thaliana] gi|30690116|ref|NP_850441.1| peroxisomal membrane protein 11D [Arabidopsis thaliana] gi|79324919|ref|NP_001031544.1| peroxisomal membrane protein 11D [Arabidopsis thaliana] gi|75099949|sp|O80845.2|PX11D_ARATH RecName: Full=Peroxisomal membrane protein 11D; AltName: Full=Peroxin-11D; Short=AtPEX11d gi|15450880|gb|AAK96711.1| Unknown protein [Arabidopsis thaliana] gi|20197204|gb|AAC28551.2| expressed protein [Arabidopsis thaliana] gi|21537163|gb|AAM61504.1| unknown [Arabidopsis thaliana] gi|330255500|gb|AEC10594.1| peroxisomal membrane protein 11D [Arabidopsis thaliana] gi|330255501|gb|AEC10595.1| peroxisomal membrane protein 11D [Arabidopsis thaliana] gi|330255502|gb|AEC10596.1| peroxisomal membrane protein 11D [Arabidopsis thaliana] Length = 236 Score = 88.2 bits (217), Expect = 1e-15 Identities = 41/54 (75%), Positives = 48/54 (88%) Frame = -1 Query: 340 SLALVKAVLDLGVCCGLLQLAPTKITPRVTGAFGFVTSVISCYQLLPSPPKTKT 179 SLAL+K+ +D+ V GLLQLAPTKITPRVTGAFGF+TS+ISCYQLLP+ PK KT Sbjct: 182 SLALIKSAMDIVVAAGLLQLAPTKITPRVTGAFGFITSIISCYQLLPTRPKIKT 235 >ref|XP_007051927.1| Peroxin 11c isoform 1 [Theobroma cacao] gi|590722555|ref|XP_007051928.1| Peroxin 11c isoform 1 [Theobroma cacao] gi|508704188|gb|EOX96084.1| Peroxin 11c isoform 1 [Theobroma cacao] gi|508704189|gb|EOX96085.1| Peroxin 11c isoform 1 [Theobroma cacao] Length = 235 Score = 87.8 bits (216), Expect = 1e-15 Identities = 42/54 (77%), Positives = 49/54 (90%) Frame = -1 Query: 340 SLALVKAVLDLGVCCGLLQLAPTKITPRVTGAFGFVTSVISCYQLLPSPPKTKT 179 +LALVKA +D+ V GLLQLAP K+TPRVTGAFGFV+S+ISCYQLLPSPPK+KT Sbjct: 181 TLALVKAGMDIVVAVGLLQLAPKKVTPRVTGAFGFVSSLISCYQLLPSPPKSKT 234 >ref|XP_006339470.1| PREDICTED: peroxisomal membrane protein 11C-like isoform X1 [Solanum tuberosum] gi|565344758|ref|XP_006339471.1| PREDICTED: peroxisomal membrane protein 11C-like isoform X2 [Solanum tuberosum] Length = 235 Score = 87.0 bits (214), Expect = 2e-15 Identities = 41/54 (75%), Positives = 48/54 (88%) Frame = -1 Query: 340 SLALVKAVLDLGVCCGLLQLAPTKITPRVTGAFGFVTSVISCYQLLPSPPKTKT 179 SLAL+KA +D+ V GLLQLAP K+TPRVTGAFGFV+S+ISCYQLLP+PPK KT Sbjct: 181 SLALIKAGIDIVVAVGLLQLAPKKVTPRVTGAFGFVSSLISCYQLLPAPPKAKT 234 >ref|XP_004229845.1| PREDICTED: peroxisomal membrane protein 11C-like isoform 1 [Solanum lycopersicum] gi|460367976|ref|XP_004229846.1| PREDICTED: peroxisomal membrane protein 11C-like isoform 2 [Solanum lycopersicum] Length = 235 Score = 87.0 bits (214), Expect = 2e-15 Identities = 41/54 (75%), Positives = 48/54 (88%) Frame = -1 Query: 340 SLALVKAVLDLGVCCGLLQLAPTKITPRVTGAFGFVTSVISCYQLLPSPPKTKT 179 SLAL+KA +D+ V GLLQLAP K+TPRVTGAFGFV+S+ISCYQLLP+PPK KT Sbjct: 181 SLALIKAGIDIVVAVGLLQLAPKKVTPRVTGAFGFVSSLISCYQLLPAPPKAKT 234 >ref|XP_002511795.1| peroxisomal biogenesis factor, putative [Ricinus communis] gi|223548975|gb|EEF50464.1| peroxisomal biogenesis factor, putative [Ricinus communis] Length = 235 Score = 86.7 bits (213), Expect = 3e-15 Identities = 42/55 (76%), Positives = 47/55 (85%) Frame = -1 Query: 340 SLALVKAVLDLGVCCGLLQLAPTKITPRVTGAFGFVTSVISCYQLLPSPPKTKTV 176 SLALVKA +D+ V GLLQLAP K+ PRVTGAFGFVTS+ISCYQLLPS PK KT+ Sbjct: 181 SLALVKAAMDIVVAVGLLQLAPKKVNPRVTGAFGFVTSLISCYQLLPSQPKAKTL 235 >ref|XP_006294921.1| hypothetical protein CARUB_v10023974mg [Capsella rubella] gi|482563629|gb|EOA27819.1| hypothetical protein CARUB_v10023974mg [Capsella rubella] Length = 236 Score = 86.3 bits (212), Expect = 4e-15 Identities = 41/54 (75%), Positives = 47/54 (87%) Frame = -1 Query: 340 SLALVKAVLDLGVCCGLLQLAPTKITPRVTGAFGFVTSVISCYQLLPSPPKTKT 179 SLAL+K+ +D+ V GLLQLAP KITPRVTGAFGF+TSVISCYQLLP+ PK KT Sbjct: 182 SLALIKSAMDIVVAAGLLQLAPKKITPRVTGAFGFITSVISCYQLLPTRPKIKT 235 >gb|EXB44728.1| Peroxisomal membrane protein 11C [Morus notabilis] Length = 235 Score = 85.9 bits (211), Expect = 5e-15 Identities = 40/54 (74%), Positives = 49/54 (90%) Frame = -1 Query: 340 SLALVKAVLDLGVCCGLLQLAPTKITPRVTGAFGFVTSVISCYQLLPSPPKTKT 179 +LAL+KA +D+ V GLLQLAP K+TPRVTGAFGFV+S+ISCYQLLPSPPK+K+ Sbjct: 181 TLALIKASVDIVVAVGLLQLAPKKVTPRVTGAFGFVSSLISCYQLLPSPPKSKS 234 >ref|XP_004133885.1| PREDICTED: peroxisomal membrane protein 11D-like [Cucumis sativus] Length = 235 Score = 85.9 bits (211), Expect = 5e-15 Identities = 41/53 (77%), Positives = 47/53 (88%) Frame = -1 Query: 340 SLALVKAVLDLGVCCGLLQLAPTKITPRVTGAFGFVTSVISCYQLLPSPPKTK 182 SLAL+KA +D+ V GLLQLAP K+TPRVTGAFGFVTS+ISCYQLLPS PK+K Sbjct: 181 SLALIKAAMDVVVAIGLLQLAPKKVTPRVTGAFGFVTSLISCYQLLPSAPKSK 233 >ref|XP_002880194.1| peroxisomal biogenesis factor 11 family protein [Arabidopsis lyrata subsp. lyrata] gi|297326033|gb|EFH56453.1| peroxisomal biogenesis factor 11 family protein [Arabidopsis lyrata subsp. lyrata] Length = 236 Score = 85.9 bits (211), Expect = 5e-15 Identities = 40/54 (74%), Positives = 47/54 (87%) Frame = -1 Query: 340 SLALVKAVLDLGVCCGLLQLAPTKITPRVTGAFGFVTSVISCYQLLPSPPKTKT 179 SLAL+K+ +D+ V GLLQLAP KITPRVTGAFGF+TS+ISCYQLLP+ PK KT Sbjct: 182 SLALIKSAMDIVVAAGLLQLAPKKITPRVTGAFGFITSIISCYQLLPTRPKIKT 235 >gb|EYU35059.1| hypothetical protein MIMGU_mgv1a012938mg [Mimulus guttatus] gi|604329903|gb|EYU35060.1| hypothetical protein MIMGU_mgv1a012938mg [Mimulus guttatus] Length = 235 Score = 85.1 bits (209), Expect = 9e-15 Identities = 41/54 (75%), Positives = 46/54 (85%) Frame = -1 Query: 340 SLALVKAVLDLGVCCGLLQLAPTKITPRVTGAFGFVTSVISCYQLLPSPPKTKT 179 SLALVKA +D+ V GLLQLAP K+TPRVTG FGFV+S+ISCYQLLPS PK KT Sbjct: 181 SLALVKAAMDIVVAVGLLQLAPKKVTPRVTGGFGFVSSLISCYQLLPSAPKAKT 234 >ref|XP_006341731.1| PREDICTED: peroxisomal membrane protein 11C-like [Solanum tuberosum] Length = 235 Score = 84.7 bits (208), Expect = 1e-14 Identities = 41/53 (77%), Positives = 46/53 (86%) Frame = -1 Query: 340 SLALVKAVLDLGVCCGLLQLAPTKITPRVTGAFGFVTSVISCYQLLPSPPKTK 182 SLAL+KA D+ V GLLQLAP K+TPRVTGAFGFV+S+ISCYQLLPSPPK K Sbjct: 181 SLALIKAGTDIVVAVGLLQLAPKKVTPRVTGAFGFVSSLISCYQLLPSPPKDK 233 >ref|XP_002889352.1| peroxisomal biogenesis factor 11 family protein [Arabidopsis lyrata subsp. lyrata] gi|297335194|gb|EFH65611.1| peroxisomal biogenesis factor 11 family protein [Arabidopsis lyrata subsp. lyrata] Length = 235 Score = 84.3 bits (207), Expect = 2e-14 Identities = 41/55 (74%), Positives = 48/55 (87%) Frame = -1 Query: 340 SLALVKAVLDLGVCCGLLQLAPTKITPRVTGAFGFVTSVISCYQLLPSPPKTKTV 176 SLAL+KA +D+ V GLLQLAP K+TPRVTGAFGF +S+ISCYQLLPS PK+KTV Sbjct: 181 SLALIKAGMDVVVAFGLLQLAPKKVTPRVTGAFGFASSLISCYQLLPSHPKSKTV 235 >ref|XP_002320762.1| peroxisomal biogenesis factor 11 family protein [Populus trichocarpa] gi|566203052|ref|XP_006375324.1| hypothetical protein POPTR_0014s07250g [Populus trichocarpa] gi|118489542|gb|ABK96573.1| unknown [Populus trichocarpa x Populus deltoides] gi|222861535|gb|EEE99077.1| peroxisomal biogenesis factor 11 family protein [Populus trichocarpa] gi|550323695|gb|ERP53121.1| hypothetical protein POPTR_0014s07250g [Populus trichocarpa] Length = 235 Score = 84.3 bits (207), Expect = 2e-14 Identities = 40/54 (74%), Positives = 47/54 (87%) Frame = -1 Query: 340 SLALVKAVLDLGVCCGLLQLAPTKITPRVTGAFGFVTSVISCYQLLPSPPKTKT 179 SLALVK+ +D+ V GLLQLAP K+TPRVTG FGFV+S+ISCYQLLPSP K+KT Sbjct: 181 SLALVKSAMDIVVAVGLLQLAPKKVTPRVTGGFGFVSSLISCYQLLPSPQKSKT 234 >ref|XP_006386590.1| hypothetical protein POPTR_0002s15510g [Populus trichocarpa] gi|550345090|gb|ERP64387.1| hypothetical protein POPTR_0002s15510g [Populus trichocarpa] Length = 180 Score = 84.0 bits (206), Expect = 2e-14 Identities = 41/54 (75%), Positives = 46/54 (85%) Frame = -1 Query: 340 SLALVKAVLDLGVCCGLLQLAPTKITPRVTGAFGFVTSVISCYQLLPSPPKTKT 179 SLALVK+ +D+ V GLLQLAP K+TPRVTGAFG VTS+ISCYQLLPSP K KT Sbjct: 126 SLALVKSAMDIVVAVGLLQLAPKKVTPRVTGAFGVVTSLISCYQLLPSPQKPKT 179 >ref|XP_002301325.1| peroxisomal biogenesis factor 11 family protein [Populus trichocarpa] gi|118484040|gb|ABK93906.1| unknown [Populus trichocarpa] gi|222843051|gb|EEE80598.1| peroxisomal biogenesis factor 11 family protein [Populus trichocarpa] Length = 235 Score = 84.0 bits (206), Expect = 2e-14 Identities = 41/54 (75%), Positives = 46/54 (85%) Frame = -1 Query: 340 SLALVKAVLDLGVCCGLLQLAPTKITPRVTGAFGFVTSVISCYQLLPSPPKTKT 179 SLALVK+ +D+ V GLLQLAP K+TPRVTGAFG VTS+ISCYQLLPSP K KT Sbjct: 181 SLALVKSAMDIVVAVGLLQLAPKKVTPRVTGAFGVVTSLISCYQLLPSPQKPKT 234 >ref|XP_006445153.1| hypothetical protein CICLE_v10022007mg [Citrus clementina] gi|567905332|ref|XP_006445154.1| hypothetical protein CICLE_v10022007mg [Citrus clementina] gi|567905334|ref|XP_006445155.1| hypothetical protein CICLE_v10022007mg [Citrus clementina] gi|568875864|ref|XP_006491010.1| PREDICTED: peroxisomal membrane protein 11D-like isoform X1 [Citrus sinensis] gi|568875866|ref|XP_006491011.1| PREDICTED: peroxisomal membrane protein 11D-like isoform X2 [Citrus sinensis] gi|568875868|ref|XP_006491012.1| PREDICTED: peroxisomal membrane protein 11D-like isoform X3 [Citrus sinensis] gi|568875870|ref|XP_006491013.1| PREDICTED: peroxisomal membrane protein 11D-like isoform X4 [Citrus sinensis] gi|557547415|gb|ESR58393.1| hypothetical protein CICLE_v10022007mg [Citrus clementina] gi|557547416|gb|ESR58394.1| hypothetical protein CICLE_v10022007mg [Citrus clementina] gi|557547417|gb|ESR58395.1| hypothetical protein CICLE_v10022007mg [Citrus clementina] Length = 235 Score = 83.6 bits (205), Expect = 3e-14 Identities = 40/53 (75%), Positives = 46/53 (86%) Frame = -1 Query: 340 SLALVKAVLDLGVCCGLLQLAPTKITPRVTGAFGFVTSVISCYQLLPSPPKTK 182 SLALVK+ +D+ V GLLQLAP K+TPRVTGAFGFVTS+ISCYQLLP+P K K Sbjct: 181 SLALVKSAMDIVVAVGLLQLAPKKVTPRVTGAFGFVTSLISCYQLLPAPVKAK 233 >ref|XP_006418462.1| hypothetical protein EUTSA_v10008643mg [Eutrema salsugineum] gi|557096233|gb|ESQ36815.1| hypothetical protein EUTSA_v10008643mg [Eutrema salsugineum] Length = 235 Score = 83.6 bits (205), Expect = 3e-14 Identities = 41/55 (74%), Positives = 47/55 (85%) Frame = -1 Query: 340 SLALVKAVLDLGVCCGLLQLAPTKITPRVTGAFGFVTSVISCYQLLPSPPKTKTV 176 SLAL+KA +D+ V GLLQLAP K+TPRVTGAFGF +S+ISCYQLLPS PK KTV Sbjct: 181 SLALIKAGMDVVVAFGLLQLAPKKVTPRVTGAFGFASSLISCYQLLPSHPKPKTV 235