BLASTX nr result
ID: Mentha28_contig00006878
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha28_contig00006878 (351 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|NP_201080.1| Hypersensitive-induced response protein 1 [Arab... 55 1e-05 ref|XP_004961021.1| PREDICTED: hypersensitive-induced response p... 55 1e-05 gb|EMT16611.1| hypothetical protein F775_27006 [Aegilops tauschii] 55 1e-05 gb|EMS61337.1| Hypersensitive-induced response protein 1 [Tritic... 55 1e-05 gb|EMS53976.1| Hypersensitive-induced response protein 1 [Tritic... 55 1e-05 gb|AFD54043.1| hypersensitive induced reaction protein 3 [Tritic... 55 1e-05 ref|XP_002888742.1| band 7 family protein [Arabidopsis lyrata su... 55 1e-05 gb|ACI25443.1| hypersensitive induced response protein 3 [Tritic... 55 1e-05 gb|AAN17464.1| hypersensitive-induced reaction protein 3 [Hordeu... 55 1e-05 >ref|NP_201080.1| Hypersensitive-induced response protein 1 [Arabidopsis thaliana] gi|75262692|sp|Q9FM19.1|HIR1_ARATH RecName: Full=Hypersensitive-induced response protein 1; Short=AtHIR1 gi|10177452|dbj|BAB10843.1| hypersensitive-induced response protein [Arabidopsis thaliana] gi|17065548|gb|AAL32928.1| hypersensitive-induced response protein [Arabidopsis thaliana] gi|21386975|gb|AAM47891.1| hypersensitive-induced response protein [Arabidopsis thaliana] gi|21554781|gb|AAM63689.1| hypersensitive-induced response protein [Arabidopsis thaliana] gi|332010266|gb|AED97649.1| Hypersensitive-induced response protein 1 [Arabidopsis thaliana] Length = 286 Score = 55.1 bits (131), Expect = 1e-05 Identities = 25/30 (83%), Positives = 28/30 (93%) Frame = -3 Query: 349 SAVFIPHGPGAVKDVAAQIRDGLLQGGSVS 260 SAVFIPHGPGAV+DVA+QIRDGLLQG S + Sbjct: 256 SAVFIPHGPGAVRDVASQIRDGLLQGSSAN 285 >ref|XP_004961021.1| PREDICTED: hypersensitive-induced response protein 1-like isoform X1 [Setaria italica] gi|514746037|ref|XP_004961022.1| PREDICTED: hypersensitive-induced response protein 1-like isoform X2 [Setaria italica] gi|514746039|ref|XP_004961023.1| PREDICTED: hypersensitive-induced response protein 1-like isoform X3 [Setaria italica] Length = 287 Score = 55.1 bits (131), Expect = 1e-05 Identities = 24/31 (77%), Positives = 29/31 (93%) Frame = -3 Query: 349 SAVFIPHGPGAVKDVAAQIRDGLLQGGSVSN 257 S+VFIPHGPGAV+D+A QIRDGLLQG +VS+ Sbjct: 256 SSVFIPHGPGAVRDIATQIRDGLLQGSAVSH 286 >gb|EMT16611.1| hypothetical protein F775_27006 [Aegilops tauschii] Length = 255 Score = 55.1 bits (131), Expect = 1e-05 Identities = 25/31 (80%), Positives = 28/31 (90%) Frame = -3 Query: 349 SAVFIPHGPGAVKDVAAQIRDGLLQGGSVSN 257 SAVFIPHGPGAV+D+A QIRDGLLQG S S+ Sbjct: 224 SAVFIPHGPGAVRDIATQIRDGLLQGQSASD 254 >gb|EMS61337.1| Hypersensitive-induced response protein 1 [Triticum urartu] Length = 295 Score = 55.1 bits (131), Expect = 1e-05 Identities = 25/31 (80%), Positives = 28/31 (90%) Frame = -3 Query: 349 SAVFIPHGPGAVKDVAAQIRDGLLQGGSVSN 257 SAVFIPHGPGAV+D+A QIRDGLLQG S S+ Sbjct: 264 SAVFIPHGPGAVRDIATQIRDGLLQGQSASD 294 >gb|EMS53976.1| Hypersensitive-induced response protein 1 [Triticum urartu] Length = 254 Score = 55.1 bits (131), Expect = 1e-05 Identities = 25/31 (80%), Positives = 28/31 (90%) Frame = -3 Query: 349 SAVFIPHGPGAVKDVAAQIRDGLLQGGSVSN 257 SAVFIPHGPGAV+D+A QIRDGLLQG S S+ Sbjct: 223 SAVFIPHGPGAVRDIATQIRDGLLQGQSASD 253 >gb|AFD54043.1| hypersensitive induced reaction protein 3 [Triticum aestivum] Length = 287 Score = 55.1 bits (131), Expect = 1e-05 Identities = 25/31 (80%), Positives = 28/31 (90%) Frame = -3 Query: 349 SAVFIPHGPGAVKDVAAQIRDGLLQGGSVSN 257 SAVFIPHGPGAV+D+A QIRDGLLQG S S+ Sbjct: 256 SAVFIPHGPGAVRDIATQIRDGLLQGQSASD 286 >ref|XP_002888742.1| band 7 family protein [Arabidopsis lyrata subsp. lyrata] gi|297334583|gb|EFH65001.1| band 7 family protein [Arabidopsis lyrata subsp. lyrata] Length = 286 Score = 55.1 bits (131), Expect = 1e-05 Identities = 24/30 (80%), Positives = 29/30 (96%) Frame = -3 Query: 349 SAVFIPHGPGAVKDVAAQIRDGLLQGGSVS 260 ++VFIPHGPGAVKD+A+QIRDGLLQG SV+ Sbjct: 256 NSVFIPHGPGAVKDIASQIRDGLLQGNSVA 285 >gb|ACI25443.1| hypersensitive induced response protein 3 [Triticum aestivum] gi|475575627|gb|EMT17323.1| hypothetical protein F775_29833 [Aegilops tauschii] Length = 287 Score = 55.1 bits (131), Expect = 1e-05 Identities = 25/31 (80%), Positives = 28/31 (90%) Frame = -3 Query: 349 SAVFIPHGPGAVKDVAAQIRDGLLQGGSVSN 257 SAVFIPHGPGAV+D+A QIRDGLLQG S S+ Sbjct: 256 SAVFIPHGPGAVRDIATQIRDGLLQGQSASD 286 >gb|AAN17464.1| hypersensitive-induced reaction protein 3 [Hordeum vulgare subsp. vulgare] gi|23345050|gb|AAN17456.1| hypersensitive-induced reaction protein 3 [Hordeum vulgare subsp. vulgare] gi|326493170|dbj|BAJ85046.1| predicted protein [Hordeum vulgare subsp. vulgare] Length = 287 Score = 55.1 bits (131), Expect = 1e-05 Identities = 25/31 (80%), Positives = 28/31 (90%) Frame = -3 Query: 349 SAVFIPHGPGAVKDVAAQIRDGLLQGGSVSN 257 SAVFIPHGPGAV+D+A QIRDGLLQG S S+ Sbjct: 256 SAVFIPHGPGAVRDIATQIRDGLLQGQSASD 286