BLASTX nr result
ID: Mentha27_contig00050254
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha27_contig00050254 (397 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EPS72698.1| hypothetical protein M569_02058, partial [Genlise... 62 1e-07 dbj|BAO49705.1| nuclear pore complex protein Nup136a [Nicotiana ... 57 3e-06 dbj|BAO49707.1| nuclear pore complex protein Nup136c [Nicotiana ... 55 8e-06 ref|XP_006345882.1| PREDICTED: uncharacterized protein YMR317W-l... 55 8e-06 >gb|EPS72698.1| hypothetical protein M569_02058, partial [Genlisea aurea] Length = 97 Score = 61.6 bits (148), Expect = 1e-07 Identities = 29/45 (64%), Positives = 32/45 (71%) Frame = +2 Query: 230 DRPAISLRGNGGGSSSWLPKLVVDPASKLISYGARRFFESIFRKR 364 DRP LRGN WL KL+VDPA KLISYGA R F+S+FRKR Sbjct: 27 DRPPAGLRGNSHKPEGWLKKLLVDPAYKLISYGADRLFDSVFRKR 71 >dbj|BAO49705.1| nuclear pore complex protein Nup136a [Nicotiana benthamiana] Length = 1308 Score = 57.0 bits (136), Expect = 3e-06 Identities = 30/45 (66%), Positives = 35/45 (77%) Frame = +2 Query: 230 DRPAISLRGNGGGSSSWLPKLVVDPASKLISYGARRFFESIFRKR 364 DRP +LR +SSWL KLVVDPASKLI+ GA+RFF SIF+KR Sbjct: 39 DRPPTTLR-----NSSWLSKLVVDPASKLITSGAQRFFSSIFQKR 78 >dbj|BAO49707.1| nuclear pore complex protein Nup136c [Nicotiana benthamiana] Length = 1470 Score = 55.5 bits (132), Expect = 8e-06 Identities = 29/47 (61%), Positives = 35/47 (74%) Frame = +2 Query: 230 DRPAISLRGNGGGSSSWLPKLVVDPASKLISYGARRFFESIFRKRRL 370 DRP +LR + SWL KLVVDPA+KLI+ GA+RFF S+FRKR L Sbjct: 40 DRPPTALR-----NPSWLTKLVVDPATKLITSGAQRFFSSLFRKRLL 81 >ref|XP_006345882.1| PREDICTED: uncharacterized protein YMR317W-like [Solanum tuberosum] Length = 1347 Score = 55.5 bits (132), Expect = 8e-06 Identities = 29/45 (64%), Positives = 34/45 (75%) Frame = +2 Query: 230 DRPAISLRGNGGGSSSWLPKLVVDPASKLISYGARRFFESIFRKR 364 DRP +LR + SWL KLVVDPA+KLI+ GARRFF SIF+KR Sbjct: 38 DRPPTALR-----NPSWLTKLVVDPATKLITSGARRFFSSIFQKR 77