BLASTX nr result
ID: Mentha27_contig00044890
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha27_contig00044890 (329 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_004489079.1| PREDICTED: uncharacterized protein LOC101515... 60 2e-07 ref|XP_004514413.1| PREDICTED: uncharacterized protein LOC101492... 58 2e-06 ref|XP_004250669.1| PREDICTED: uncharacterized protein LOC101268... 57 2e-06 dbj|BAL46524.1| hypothetical protein [Gentiana scabra x Gentiana... 55 8e-06 >ref|XP_004489079.1| PREDICTED: uncharacterized protein LOC101515713 [Cicer arietinum] Length = 943 Score = 60.5 bits (145), Expect = 2e-07 Identities = 21/37 (56%), Positives = 29/37 (78%) Frame = -1 Query: 128 QCPKCKKNHTGECWRGKNVCYSCGDPGHMSYNCPKRK 18 +CPKC ++H GEC GKN+C+ C PGH+S +CP+RK Sbjct: 267 ECPKCGRSHPGECLYGKNICFWCKTPGHLSQDCPQRK 303 >ref|XP_004514413.1| PREDICTED: uncharacterized protein LOC101492066, partial [Cicer arietinum] Length = 449 Score = 57.8 bits (138), Expect = 2e-06 Identities = 22/37 (59%), Positives = 28/37 (75%) Frame = -1 Query: 128 QCPKCKKNHTGECWRGKNVCYSCGDPGHMSYNCPKRK 18 +CPKC ++H GEC GKNVC+ C GHMS +CP+RK Sbjct: 116 KCPKCGRSHPGECLYGKNVCFWCKISGHMSQDCPQRK 152 >ref|XP_004250669.1| PREDICTED: uncharacterized protein LOC101268343 [Solanum lycopersicum] Length = 191 Score = 57.4 bits (137), Expect = 2e-06 Identities = 20/36 (55%), Positives = 24/36 (66%) Frame = -1 Query: 125 CPKCKKNHTGECWRGKNVCYSCGDPGHMSYNCPKRK 18 CPKC KNH GEC GK +C+ CG GH +CP R+ Sbjct: 147 CPKCSKNHPGECLAGKEICFGCGQSGHRLRDCPSRQ 182 >dbj|BAL46524.1| hypothetical protein [Gentiana scabra x Gentiana triflora] Length = 488 Score = 55.5 bits (132), Expect = 8e-06 Identities = 21/34 (61%), Positives = 23/34 (67%) Frame = -1 Query: 125 CPKCKKNHTGECWRGKNVCYSCGDPGHMSYNCPK 24 C KC K HT EC G N CY+CG+ GH S NCPK Sbjct: 409 CSKCNKTHTRECRSGGNSCYNCGETGHFSRNCPK 442