BLASTX nr result
ID: Mentha27_contig00044854
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha27_contig00044854 (211 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|ACN32306.1| RADIALIS, partial [Gratiola officinalis] 81 1e-13 sp|Q58FS3.1|RAD_ANTMA RecName: Full=Transcription factor RADIALI... 74 2e-11 ref|XP_002509490.1| DNA binding protein, putative [Ricinus commu... 74 3e-11 ref|XP_007201464.1| hypothetical protein PRUPE_ppa014060mg [Prun... 70 3e-10 ref|XP_002305430.1| myb family transcription factor family prote... 70 3e-10 ref|XP_004289671.1| PREDICTED: transcription factor RADIALIS-lik... 70 4e-10 ref|XP_003521116.1| PREDICTED: protein RADIALIS-like 1-like [Gly... 70 4e-10 ref|XP_003624937.1| hypothetical protein MTR_7g089210 [Medicago ... 69 9e-10 gb|ABN08550.1| Homeodomain-related [Medicago truncatula] 69 9e-10 ref|XP_002313794.1| myb family transcription factor family prote... 67 2e-09 ref|XP_007162062.1| hypothetical protein PHAVU_001G120400g [Phas... 67 3e-09 gb|ABM97744.1| RAD [Oreocharis leiophylla] gi|124494164|gb|ABN13... 67 3e-09 ref|NP_001236080.1| MYB transcription factor MYB142 [Glycine max... 67 3e-09 emb|CBI32595.3| unnamed protein product [Vitis vinifera] 66 4e-09 ref|XP_003631660.1| PREDICTED: dnaJ homolog subfamily C member 2... 66 4e-09 ref|XP_004304977.1| PREDICTED: protein RADIALIS-like 1-like [Fra... 66 6e-09 gb|ACN32305.1| RADIALIS, partial [Veronica serpyllifolia] 66 6e-09 gb|ACN32304.1| RADIALIS [Veronica serpyllifolia] 66 6e-09 gb|ADX59503.1| RADIALIS [Wulfenia carinthiaca] 65 7e-09 ref|XP_006423271.1| hypothetical protein CICLE_v10029663mg [Citr... 65 1e-08 >gb|ACN32306.1| RADIALIS, partial [Gratiola officinalis] Length = 82 Score = 81.3 bits (199), Expect = 1e-13 Identities = 34/44 (77%), Positives = 41/44 (93%) Frame = +1 Query: 1 AIGGRTPEEVKMHYDVLVEDIKYIESGKVPFPNYKTTNGGGSFK 132 A+GGRTPEEVK HY++LVEDIK+IESG+VPFPNY+TT GGGS + Sbjct: 20 AVGGRTPEEVKRHYEILVEDIKFIESGRVPFPNYRTTGGGGSMR 63 >sp|Q58FS3.1|RAD_ANTMA RecName: Full=Transcription factor RADIALIS gi|118137433|pdb|2CJJ|A Chain A, Crystal Structure Of The Myb Domain Of The Rad Transcription Factor From Antirrhinum Majus gi|61652985|gb|AAX48042.1| RADIALIS [Antirrhinum majus] Length = 93 Score = 73.9 bits (180), Expect = 2e-11 Identities = 32/39 (82%), Positives = 36/39 (92%) Frame = +1 Query: 1 AIGGRTPEEVKMHYDVLVEDIKYIESGKVPFPNYKTTNG 117 A+ GRTPEEVK HY++LVEDIKYIESGKVPFPNY+TT G Sbjct: 40 AVEGRTPEEVKKHYEILVEDIKYIESGKVPFPNYRTTGG 78 >ref|XP_002509490.1| DNA binding protein, putative [Ricinus communis] gi|223549389|gb|EEF50877.1| DNA binding protein, putative [Ricinus communis] Length = 107 Score = 73.6 bits (179), Expect = 3e-11 Identities = 31/42 (73%), Positives = 38/42 (90%) Frame = +1 Query: 1 AIGGRTPEEVKMHYDVLVEDIKYIESGKVPFPNYKTTNGGGS 126 A+GG+TPEEVK HYD+LVED+KYIESG+VPFPNY+TT G+ Sbjct: 43 AVGGKTPEEVKRHYDLLVEDVKYIESGQVPFPNYRTTGTRGN 84 >ref|XP_007201464.1| hypothetical protein PRUPE_ppa014060mg [Prunus persica] gi|462396864|gb|EMJ02663.1| hypothetical protein PRUPE_ppa014060mg [Prunus persica] Length = 89 Score = 70.1 bits (170), Expect = 3e-10 Identities = 30/45 (66%), Positives = 38/45 (84%) Frame = +1 Query: 1 AIGGRTPEEVKMHYDVLVEDIKYIESGKVPFPNYKTTNGGGSFKR 135 A+GG+TPEEVK HY+ LVED+K+IESG+VPFP+Y+TT G KR Sbjct: 38 AVGGKTPEEVKRHYERLVEDVKHIESGQVPFPDYRTTGGNDEEKR 82 >ref|XP_002305430.1| myb family transcription factor family protein [Populus trichocarpa] gi|222848394|gb|EEE85941.1| myb family transcription factor family protein [Populus trichocarpa] Length = 99 Score = 70.1 bits (170), Expect = 3e-10 Identities = 29/44 (65%), Positives = 37/44 (84%) Frame = +1 Query: 1 AIGGRTPEEVKMHYDVLVEDIKYIESGKVPFPNYKTTNGGGSFK 132 A+GG+T EEVK HY++LVED+K+IESG+VPFPNY+TT G K Sbjct: 43 AVGGKTAEEVKRHYEILVEDVKHIESGRVPFPNYRTTGANGHSK 86 >ref|XP_004289671.1| PREDICTED: transcription factor RADIALIS-like [Fragaria vesca subsp. vesca] Length = 100 Score = 69.7 bits (169), Expect = 4e-10 Identities = 28/42 (66%), Positives = 38/42 (90%) Frame = +1 Query: 1 AIGGRTPEEVKMHYDVLVEDIKYIESGKVPFPNYKTTNGGGS 126 A+G +TPEEVK HYD+LVED+K+IESG+VPFP+Y+T+ G G+ Sbjct: 44 AVGNKTPEEVKRHYDLLVEDVKHIESGQVPFPDYRTSGGSGN 85 >ref|XP_003521116.1| PREDICTED: protein RADIALIS-like 1-like [Glycine max] Length = 97 Score = 69.7 bits (169), Expect = 4e-10 Identities = 28/42 (66%), Positives = 37/42 (88%) Frame = +1 Query: 1 AIGGRTPEEVKMHYDVLVEDIKYIESGKVPFPNYKTTNGGGS 126 A+GG+TPEEVK HY++LV+D+K+IESG+VPFPNYK T G + Sbjct: 41 AVGGKTPEEVKRHYELLVQDVKHIESGRVPFPNYKKTTSGST 82 >ref|XP_003624937.1| hypothetical protein MTR_7g089210 [Medicago truncatula] gi|355499952|gb|AES81155.1| hypothetical protein MTR_7g089210 [Medicago truncatula] Length = 88 Score = 68.6 bits (166), Expect = 9e-10 Identities = 31/45 (68%), Positives = 37/45 (82%) Frame = +1 Query: 1 AIGGRTPEEVKMHYDVLVEDIKYIESGKVPFPNYKTTNGGGSFKR 135 A+GG+TPEEVK HY++LVEDIK+IESGKVPFPNYK + KR Sbjct: 41 AVGGKTPEEVKKHYELLVEDIKHIESGKVPFPNYKKISVSHEEKR 85 >gb|ABN08550.1| Homeodomain-related [Medicago truncatula] Length = 92 Score = 68.6 bits (166), Expect = 9e-10 Identities = 31/45 (68%), Positives = 37/45 (82%) Frame = +1 Query: 1 AIGGRTPEEVKMHYDVLVEDIKYIESGKVPFPNYKTTNGGGSFKR 135 A+GG+TPEEVK HY++LVEDIK+IESGKVPFPNYK + KR Sbjct: 41 AVGGKTPEEVKKHYELLVEDIKHIESGKVPFPNYKKISVSHEEKR 85 >ref|XP_002313794.1| myb family transcription factor family protein [Populus trichocarpa] gi|222850202|gb|EEE87749.1| myb family transcription factor family protein [Populus trichocarpa] Length = 87 Score = 67.4 bits (163), Expect = 2e-09 Identities = 28/41 (68%), Positives = 35/41 (85%) Frame = +1 Query: 1 AIGGRTPEEVKMHYDVLVEDIKYIESGKVPFPNYKTTNGGG 123 A+GG+T EEVK HY++LVED+K+IESG VPFPNY+TT G Sbjct: 43 AVGGKTAEEVKRHYELLVEDVKHIESGHVPFPNYRTTGANG 83 >ref|XP_007162062.1| hypothetical protein PHAVU_001G120400g [Phaseolus vulgaris] gi|561035526|gb|ESW34056.1| hypothetical protein PHAVU_001G120400g [Phaseolus vulgaris] Length = 129 Score = 67.0 bits (162), Expect = 3e-09 Identities = 27/37 (72%), Positives = 35/37 (94%) Frame = +1 Query: 1 AIGGRTPEEVKMHYDVLVEDIKYIESGKVPFPNYKTT 111 A+GG+TPEEVK HY++LV+D+K+IESG+VPFPNYK T Sbjct: 77 AVGGKTPEEVKRHYELLVQDVKHIESGRVPFPNYKKT 113 >gb|ABM97744.1| RAD [Oreocharis leiophylla] gi|124494164|gb|ABN13125.1| transcription factor RAD [Oreocharis leiophylla] Length = 85 Score = 67.0 bits (162), Expect = 3e-09 Identities = 30/44 (68%), Positives = 35/44 (79%) Frame = +1 Query: 1 AIGGRTPEEVKMHYDVLVEDIKYIESGKVPFPNYKTTNGGGSFK 132 A+ GRT EEVK HY++LVED+K IESGKVPFPNY+T GS K Sbjct: 37 AVPGRTVEEVKRHYEILVEDVKSIESGKVPFPNYRTIRESGSMK 80 >ref|NP_001236080.1| MYB transcription factor MYB142 [Glycine max] gi|110931736|gb|ABH02867.1| MYB transcription factor MYB142 [Glycine max] Length = 97 Score = 67.0 bits (162), Expect = 3e-09 Identities = 27/37 (72%), Positives = 35/37 (94%) Frame = +1 Query: 1 AIGGRTPEEVKMHYDVLVEDIKYIESGKVPFPNYKTT 111 A+GG+TPEEVK HY++LV+D+K+IESG+VPFPNYK T Sbjct: 41 AVGGKTPEEVKRHYELLVQDVKHIESGRVPFPNYKKT 77 >emb|CBI32595.3| unnamed protein product [Vitis vinifera] Length = 111 Score = 66.2 bits (160), Expect = 4e-09 Identities = 29/41 (70%), Positives = 34/41 (82%) Frame = +1 Query: 1 AIGGRTPEEVKMHYDVLVEDIKYIESGKVPFPNYKTTNGGG 123 A+GG+T EEVK HY++LVEDIK I+S KVPFPNYKTT G Sbjct: 54 AVGGKTVEEVKRHYEILVEDIKSIDSDKVPFPNYKTTGASG 94 >ref|XP_003631660.1| PREDICTED: dnaJ homolog subfamily C member 2-like [Vitis vinifera] Length = 101 Score = 66.2 bits (160), Expect = 4e-09 Identities = 29/41 (70%), Positives = 34/41 (82%) Frame = +1 Query: 1 AIGGRTPEEVKMHYDVLVEDIKYIESGKVPFPNYKTTNGGG 123 A+GG+T EEVK HY++LVEDIK I+S KVPFPNYKTT G Sbjct: 44 AVGGKTVEEVKRHYEILVEDIKSIDSDKVPFPNYKTTGASG 84 >ref|XP_004304977.1| PREDICTED: protein RADIALIS-like 1-like [Fragaria vesca subsp. vesca] Length = 112 Score = 65.9 bits (159), Expect = 6e-09 Identities = 26/41 (63%), Positives = 36/41 (87%) Frame = +1 Query: 4 IGGRTPEEVKMHYDVLVEDIKYIESGKVPFPNYKTTNGGGS 126 +G +TPEEVK HYD+L+ED+K IESG+VPFP+Y+T+ G G+ Sbjct: 46 VGNKTPEEVKRHYDLLLEDVKLIESGEVPFPDYRTSGGSGN 86 >gb|ACN32305.1| RADIALIS, partial [Veronica serpyllifolia] Length = 87 Score = 65.9 bits (159), Expect = 6e-09 Identities = 30/42 (71%), Positives = 37/42 (88%), Gaps = 1/42 (2%) Frame = +1 Query: 1 AIG-GRTPEEVKMHYDVLVEDIKYIESGKVPFPNYKTTNGGG 123 A+G GRT EEVK HY++L+EDI YIESGKV +PNY+TT+GGG Sbjct: 20 AVGAGRTVEEVKRHYEILLEDIGYIESGKVAYPNYRTTSGGG 61 >gb|ACN32304.1| RADIALIS [Veronica serpyllifolia] Length = 82 Score = 65.9 bits (159), Expect = 6e-09 Identities = 30/42 (71%), Positives = 37/42 (88%), Gaps = 1/42 (2%) Frame = +1 Query: 1 AIG-GRTPEEVKMHYDVLVEDIKYIESGKVPFPNYKTTNGGG 123 A+G GRT EEVK HY++L+EDI YIESGKV +PNY+TT+GGG Sbjct: 15 AVGAGRTVEEVKRHYEILLEDIGYIESGKVAYPNYRTTSGGG 56 >gb|ADX59503.1| RADIALIS [Wulfenia carinthiaca] Length = 53 Score = 65.5 bits (158), Expect = 7e-09 Identities = 28/35 (80%), Positives = 32/35 (91%) Frame = +1 Query: 1 AIGGRTPEEVKMHYDVLVEDIKYIESGKVPFPNYK 105 A+GGRT EEVK HY++LVEDI YIESGKVPFPNY+ Sbjct: 19 AVGGRTAEEVKRHYEILVEDIHYIESGKVPFPNYR 53 >ref|XP_006423271.1| hypothetical protein CICLE_v10029663mg [Citrus clementina] gi|568829699|ref|XP_006469157.1| PREDICTED: protein RADIALIS-like 2-like [Citrus sinensis] gi|557525205|gb|ESR36511.1| hypothetical protein CICLE_v10029663mg [Citrus clementina] Length = 96 Score = 65.1 bits (157), Expect = 1e-08 Identities = 27/42 (64%), Positives = 36/42 (85%) Frame = +1 Query: 1 AIGGRTPEEVKMHYDVLVEDIKYIESGKVPFPNYKTTNGGGS 126 A+GG+T +EVK HY++LVEDIK+IESG VPFP Y+T +G G+ Sbjct: 44 AVGGKTADEVKKHYELLVEDIKHIESGHVPFPKYRTPSGNGN 85