BLASTX nr result
ID: Mentha27_contig00042872
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha27_contig00042872 (287 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EYU21418.1| hypothetical protein MIMGU_mgv11b023454mg [Mimulu... 100 2e-19 gb|EYU23130.1| hypothetical protein MIMGU_mgv11b020602mg [Mimulu... 95 9e-18 gb|EYU21416.1| hypothetical protein MIMGU_mgv1a023126mg [Mimulus... 94 3e-17 gb|EYU21391.1| hypothetical protein MIMGU_mgv1a017921mg [Mimulus... 89 8e-16 gb|EYU21429.1| hypothetical protein MIMGU_mgv1a026954mg, partial... 87 3e-15 gb|EYU45438.1| hypothetical protein MIMGU_mgv1a000800mg [Mimulus... 84 2e-14 gb|EYU21492.1| hypothetical protein MIMGU_mgv11b018713mg [Mimulu... 84 2e-14 gb|EYU21490.1| hypothetical protein MIMGU_mgv1a019882mg, partial... 83 4e-14 gb|EYU21411.1| hypothetical protein MIMGU_mgv1a000761mg [Mimulus... 80 2e-13 gb|EYU21414.1| hypothetical protein MIMGU_mgv1a026323mg [Mimulus... 73 4e-11 ref|XP_007023018.1| Cysteine/Histidine-rich C1 domain family pro... 71 2e-10 gb|EYU21494.1| hypothetical protein MIMGU_mgv1a023250mg [Mimulus... 69 5e-10 ref|XP_002520413.1| hypothetical protein RCOM_1397400 [Ricinus c... 67 2e-09 ref|XP_004305491.1| PREDICTED: putative disease resistance prote... 67 3e-09 ref|XP_007024392.1| Cc-nbs-lrr resistance protein, putative [The... 67 3e-09 gb|EYU38135.1| hypothetical protein MIMGU_mgv1a018675mg, partial... 66 4e-09 ref|XP_007225342.1| hypothetical protein PRUPE_ppa001008mg [Prun... 66 6e-09 ref|XP_002520416.1| leucine-rich repeat containing protein, puta... 66 6e-09 ref|XP_002515943.1| leucine-rich repeat containing protein, puta... 65 1e-08 ref|XP_007217454.1| hypothetical protein PRUPE_ppb019479mg [Prun... 65 1e-08 >gb|EYU21418.1| hypothetical protein MIMGU_mgv11b023454mg [Mimulus guttatus] Length = 1023 Score = 100 bits (249), Expect = 2e-19 Identities = 52/95 (54%), Positives = 66/95 (69%) Frame = +1 Query: 1 IHLRFLHLGGGRIHNKQLKTICCLYFLQTLLLPSCALVQVPIKIKNLVELRRLNLSNNVD 180 IHLR+L LG + K LKTIC LY LQ L L SC L ++P +I NL+ L+ L+L +N Sbjct: 608 IHLRWLDLGHNKFPAKDLKTICKLYNLQFLWLNSCELEEIPREIGNLIHLKHLDLQSNGV 667 Query: 181 LKELPDSICSLIELRSLDLDFCHSLRRLPEGINHL 285 LKELP+S+C L EL SLD+ C+ L RLPEGI+ L Sbjct: 668 LKELPESLCDLRELESLDISACYCLSRLPEGIHRL 702 >gb|EYU23130.1| hypothetical protein MIMGU_mgv11b020602mg [Mimulus guttatus] Length = 977 Score = 95.1 bits (235), Expect = 9e-18 Identities = 48/95 (50%), Positives = 68/95 (71%) Frame = +1 Query: 1 IHLRFLHLGGGRIHNKQLKTICCLYFLQTLLLPSCALVQVPIKIKNLVELRRLNLSNNVD 180 IHLR+L+LG + HN+ +K IC LY L+ +LL C L +V KI NL+ L L+LS N Sbjct: 574 IHLRWLNLGQNKFHNEDIKYICNLYNLKFVLLDMCQLQEVSSKIGNLIHLIHLDLSYNNL 633 Query: 181 LKELPDSICSLIELRSLDLDFCHSLRRLPEGINHL 285 LKELP+++C+L EL +L+++ C SL RLP+GI+ L Sbjct: 634 LKELPETLCNLCELETLNVNGCESLSRLPQGISRL 668 >gb|EYU21416.1| hypothetical protein MIMGU_mgv1a023126mg [Mimulus guttatus] Length = 999 Score = 93.6 bits (231), Expect = 3e-17 Identities = 47/95 (49%), Positives = 66/95 (69%) Frame = +1 Query: 1 IHLRFLHLGGGRIHNKQLKTICCLYFLQTLLLPSCALVQVPIKIKNLVELRRLNLSNNVD 180 IHLR+L+LG H++ +KT+C LY LQ L L C L ++ KI NLV L L+LS N Sbjct: 557 IHLRWLNLGRNNFHDQDVKTVCKLYNLQFLWLDVCRLEEISSKIGNLVHLIHLDLSYNNL 616 Query: 181 LKELPDSICSLIELRSLDLDFCHSLRRLPEGINHL 285 LKELP+ +C+L +L +L++D C SL +LP+GI+ L Sbjct: 617 LKELPEKVCNLCKLETLNVDGCESLSKLPQGIHRL 651 >gb|EYU21391.1| hypothetical protein MIMGU_mgv1a017921mg [Mimulus guttatus] Length = 956 Score = 88.6 bits (218), Expect = 8e-16 Identities = 47/96 (48%), Positives = 66/96 (68%), Gaps = 1/96 (1%) Frame = +1 Query: 1 IHLRFLHLGGGRIHNKQ-LKTICCLYFLQTLLLPSCALVQVPIKIKNLVELRRLNLSNNV 177 IHLR+L+L K LK+IC LY LQ LL+ C L ++P +I NL +L+ LNLS+N Sbjct: 591 IHLRWLYLSSSHFMAKDALKSICKLYNLQFLLVEMCDLTEIPHEIGNLTKLKELNLSSNR 650 Query: 178 DLKELPDSICSLIELRSLDLDFCHSLRRLPEGINHL 285 ++ELP+S+C+L EL SL++ C L RLP+GI+ L Sbjct: 651 LIEELPESMCNLRELESLNIKSCEGLVRLPQGIHRL 686 >gb|EYU21429.1| hypothetical protein MIMGU_mgv1a026954mg, partial [Mimulus guttatus] Length = 1138 Score = 86.7 bits (213), Expect = 3e-15 Identities = 45/95 (47%), Positives = 65/95 (68%) Frame = +1 Query: 1 IHLRFLHLGGGRIHNKQLKTICCLYFLQTLLLPSCALVQVPIKIKNLVELRRLNLSNNVD 180 IHLR+L+L ++ LK+IC LY LQ L + C L ++P++I NL EL L+LS+N Sbjct: 573 IHLRWLNLSHNKLVGDDLKSICKLYNLQFLWVGWCGLQEIPLEIGNLSELIHLDLSDNTQ 632 Query: 181 LKELPDSICSLIELRSLDLDFCHSLRRLPEGINHL 285 LKELP+S+C+L +L L++ C SL LP+GI+ L Sbjct: 633 LKELPESLCNLSKLEILNVSSCCSLCGLPQGIHRL 667 >gb|EYU45438.1| hypothetical protein MIMGU_mgv1a000800mg [Mimulus guttatus] Length = 982 Score = 84.3 bits (207), Expect = 2e-14 Identities = 44/96 (45%), Positives = 68/96 (70%), Gaps = 1/96 (1%) Frame = +1 Query: 1 IHLRFLHLGGGRIHNKQ-LKTICCLYFLQTLLLPSCALVQVPIKIKNLVELRRLNLSNNV 177 IHLR+L L + LK+IC LY LQ LL+ C + ++P +I NL++L+ L+LS+N Sbjct: 606 IHLRWLDLSWNYFGAENGLKSICKLYNLQFLLVGGCKIKEIPREIGNLIQLKELDLSSNT 665 Query: 178 DLKELPDSICSLIELRSLDLDFCHSLRRLPEGINHL 285 ++ELP+S+C+L EL SL+++ C +L RLP+GI+ L Sbjct: 666 VIEELPESMCNLRELESLNINSCVALVRLPQGIHRL 701 >gb|EYU21492.1| hypothetical protein MIMGU_mgv11b018713mg [Mimulus guttatus] Length = 1155 Score = 84.3 bits (207), Expect = 2e-14 Identities = 45/95 (47%), Positives = 64/95 (67%) Frame = +1 Query: 1 IHLRFLHLGGGRIHNKQLKTICCLYFLQTLLLPSCALVQVPIKIKNLVELRRLNLSNNVD 180 IHLR+L+L + LK+IC LY LQ L + C L ++P++I NL EL L+LS N Sbjct: 595 IHLRWLNLSNNKFVGDDLKSICKLYNLQFLWVDWCGLQEIPLEIGNLSELIHLDLSWNRG 654 Query: 181 LKELPDSICSLIELRSLDLDFCHSLRRLPEGINHL 285 L ELP+S+C+L +L SL+++ C SL LP+GI+ L Sbjct: 655 LGELPESLCNLSKLESLNVNECRSLCGLPQGIHRL 689 >gb|EYU21490.1| hypothetical protein MIMGU_mgv1a019882mg, partial [Mimulus guttatus] Length = 648 Score = 82.8 bits (203), Expect = 4e-14 Identities = 44/95 (46%), Positives = 62/95 (65%) Frame = +1 Query: 1 IHLRFLHLGGGRIHNKQLKTICCLYFLQTLLLPSCALVQVPIKIKNLVELRRLNLSNNVD 180 IHLR+L LG LK+IC LY LQ L L C L ++ +I+NL +L +LS N Sbjct: 511 IHLRWLDLGNNEFVGDDLKSICKLYNLQFLWLDLCELKRISSEIENLSQLIHFDLSENRQ 570 Query: 181 LKELPDSICSLIELRSLDLDFCHSLRRLPEGINHL 285 L+ELP+S+C+L +L SLD+++C SL LP+ I+ L Sbjct: 571 LRELPESLCNLSKLESLDVNWCSSLCGLPQEIHKL 605 >gb|EYU21411.1| hypothetical protein MIMGU_mgv1a000761mg [Mimulus guttatus] Length = 992 Score = 80.5 bits (197), Expect = 2e-13 Identities = 44/96 (45%), Positives = 65/96 (67%), Gaps = 1/96 (1%) Frame = +1 Query: 1 IHLRFLHLGGGR-IHNKQLKTICCLYFLQTLLLPSCALVQVPIKIKNLVELRRLNLSNNV 177 IHLR L LG + + + LK IC LY L+ L L C L ++P +I++L+ + L+LSNN Sbjct: 578 IHLRSLDLGCNKFLDERDLKGICKLYNLRFLWLDGCRLKEIPSEIRDLIHMIHLDLSNN- 636 Query: 178 DLKELPDSICSLIELRSLDLDFCHSLRRLPEGINHL 285 + ELPDS+C ++EL SL++ C SL RLP+G++ L Sbjct: 637 EFVELPDSLCDMLELESLNVYNCISLVRLPQGMHRL 672 >gb|EYU21414.1| hypothetical protein MIMGU_mgv1a026323mg [Mimulus guttatus] Length = 890 Score = 73.2 bits (178), Expect = 4e-11 Identities = 38/81 (46%), Positives = 56/81 (69%) Frame = +1 Query: 43 NKQLKTICCLYFLQTLLLPSCALVQVPIKIKNLVELRRLNLSNNVDLKELPDSICSLIEL 222 ++ LK+IC LY LQ L + C ++++P +I NL+ L+ L+LS N KELP+S+C LIEL Sbjct: 540 DEDLKSICKLYSLQFLWVDHCEVLEIPHEIGNLIHLKHLDLSWNKLQKELPESLCGLIEL 599 Query: 223 RSLDLDFCHSLRRLPEGINHL 285 SL++ C L LP+GI+ L Sbjct: 600 ESLNVYSCGYLIGLPKGIHRL 620 >ref|XP_007023018.1| Cysteine/Histidine-rich C1 domain family protein [Theobroma cacao] gi|508778384|gb|EOY25640.1| Cysteine/Histidine-rich C1 domain family protein [Theobroma cacao] Length = 1623 Score = 70.9 bits (172), Expect = 2e-10 Identities = 31/59 (52%), Positives = 44/59 (74%) Frame = +1 Query: 109 LVQVPIKIKNLVELRRLNLSNNVDLKELPDSICSLIELRSLDLDFCHSLRRLPEGINHL 285 + ++P +I L+ LR LN+SNN DL+ELP+++C LI L++LDL FC L+RLP GI L Sbjct: 603 ITEIPKEIAKLIHLRYLNISNNDDLEELPEALCELINLQTLDLSFCKKLKRLPNGIGKL 661 >gb|EYU21494.1| hypothetical protein MIMGU_mgv1a023250mg [Mimulus guttatus] Length = 873 Score = 69.3 bits (168), Expect = 5e-10 Identities = 33/63 (52%), Positives = 47/63 (74%) Frame = +1 Query: 97 PSCALVQVPIKIKNLVELRRLNLSNNVDLKELPDSICSLIELRSLDLDFCHSLRRLPEGI 276 P C L ++P++I NL EL L+LS N L+ELP+S+C+L +L SLD+++C SLR LP GI Sbjct: 542 PLCGLQEIPLEIGNLSELIHLDLSWNRGLRELPESLCNLSKLESLDVNWCESLRGLPRGI 601 Query: 277 NHL 285 + L Sbjct: 602 HRL 604 >ref|XP_002520413.1| hypothetical protein RCOM_1397400 [Ricinus communis] gi|223540398|gb|EEF41968.1| hypothetical protein RCOM_1397400 [Ricinus communis] Length = 387 Score = 67.4 bits (163), Expect = 2e-09 Identities = 30/69 (43%), Positives = 49/69 (71%) Frame = +1 Query: 79 LQTLLLPSCALVQVPIKIKNLVELRRLNLSNNVDLKELPDSICSLIELRSLDLDFCHSLR 258 L++L L +C L ++P I+ L+ LR+++LS N DLK LP+++C L L++L++D C SL Sbjct: 45 LRSLNLSNCNLAEIPSSIRKLIHLRQIDLSYNKDLKGLPEALCELCNLQTLNMDGCFSLV 104 Query: 259 RLPEGINHL 285 +LP G+ L Sbjct: 105 KLPRGVEKL 113 >ref|XP_004305491.1| PREDICTED: putative disease resistance protein RGA3-like [Fragaria vesca subsp. vesca] Length = 885 Score = 67.0 bits (162), Expect = 3e-09 Identities = 46/120 (38%), Positives = 58/120 (48%), Gaps = 25/120 (20%) Frame = +1 Query: 1 IHLRFLHLGGGRIHNKQLKTICCLYFLQTLLLPSCA------------------------ 108 IHLR++ L RI + T+C LY LQTL L SC Sbjct: 600 IHLRYISLSHNRIFKELPYTMCELYNLQTLHLISCERLEKLPEGMDKLGNLRNLHVIGCG 659 Query: 109 -LVQVPIKIKNLVELRRLNLSNNVDLKELPDSICSLIELRSLDLDFCHSLRRLPEGINHL 285 LV +P I LV LR ++LS N LK LPD +C L +L++L L +C L LPE I L Sbjct: 660 ELVSLPGVIGKLVCLRYIDLSANCSLKNLPDGLCDLNKLQTLRLSWCTGLEALPEAIGKL 719 Score = 59.7 bits (143), Expect = 4e-07 Identities = 36/94 (38%), Positives = 53/94 (56%) Frame = +1 Query: 4 HLRFLHLGGGRIHNKQLKTICCLYFLQTLLLPSCALVQVPIKIKNLVELRRLNLSNNVDL 183 +LR L I L I L +L+TL L + +VP I +L+ LR ++LS+N Sbjct: 554 NLRTLTTFDSEISTLDLDLILQLKYLRTLSLNCDRIHEVPTSIGSLIHLRYISLSHNRIF 613 Query: 184 KELPDSICSLIELRSLDLDFCHSLRRLPEGINHL 285 KELP ++C L L++L L C L +LPEG++ L Sbjct: 614 KELPYTMCELYNLQTLHLISCERLEKLPEGMDKL 647 >ref|XP_007024392.1| Cc-nbs-lrr resistance protein, putative [Theobroma cacao] gi|508779758|gb|EOY27014.1| Cc-nbs-lrr resistance protein, putative [Theobroma cacao] Length = 954 Score = 66.6 bits (161), Expect = 3e-09 Identities = 34/72 (47%), Positives = 47/72 (65%) Frame = +1 Query: 70 LYFLQTLLLPSCALVQVPIKIKNLVELRRLNLSNNVDLKELPDSICSLIELRSLDLDFCH 249 L L++L L C + ++P +I L+ LR L LSNN L+ELP+++C L L++LDL C Sbjct: 573 LICLRSLDLSWCLIKEIPKEIGKLIRLRYLKLSNNHHLRELPETLCDLYNLQTLDLTRCR 632 Query: 250 SLRRLPEGINHL 285 SLR LP GI L Sbjct: 633 SLRTLPSGIGKL 644 >gb|EYU38135.1| hypothetical protein MIMGU_mgv1a018675mg, partial [Mimulus guttatus] Length = 878 Score = 66.2 bits (160), Expect = 4e-09 Identities = 31/69 (44%), Positives = 48/69 (69%) Frame = +1 Query: 79 LQTLLLPSCALVQVPIKIKNLVELRRLNLSNNVDLKELPDSICSLIELRSLDLDFCHSLR 258 L+ L L C L ++P +I NL++L L++S+N +KELP+ +C+L EL SL++D C SL Sbjct: 563 LRLLSLRKCGLQKIPREIGNLIKLIHLDMSSNKRVKELPEMLCNLRELESLNIDSCESLA 622 Query: 259 RLPEGINHL 285 LP G++ L Sbjct: 623 HLPRGVHRL 631 >ref|XP_007225342.1| hypothetical protein PRUPE_ppa001008mg [Prunus persica] gi|462422278|gb|EMJ26541.1| hypothetical protein PRUPE_ppa001008mg [Prunus persica] Length = 934 Score = 65.9 bits (159), Expect = 6e-09 Identities = 38/94 (40%), Positives = 54/94 (57%) Frame = +1 Query: 4 HLRFLHLGGGRIHNKQLKTICCLYFLQTLLLPSCALVQVPIKIKNLVELRRLNLSNNVDL 183 +LR L RI I L L+TL L ++ ++P +I L+ LR ++LS N DL Sbjct: 564 YLRTLATFDSRITTIDSNLILQLKRLRTLNLSGNSIKELPEEIGELIHLRHIDLSYNCDL 623 Query: 184 KELPDSICSLIELRSLDLDFCHSLRRLPEGINHL 285 ++LPDSIC L L +L L FC L++LPE + L Sbjct: 624 EKLPDSICGLYNLSTLSLRFCSKLKKLPENMGSL 657 >ref|XP_002520416.1| leucine-rich repeat containing protein, putative [Ricinus communis] gi|223540401|gb|EEF41971.1| leucine-rich repeat containing protein, putative [Ricinus communis] Length = 661 Score = 65.9 bits (159), Expect = 6e-09 Identities = 30/69 (43%), Positives = 48/69 (69%) Frame = +1 Query: 79 LQTLLLPSCALVQVPIKIKNLVELRRLNLSNNVDLKELPDSICSLIELRSLDLDFCHSLR 258 L++L L +C L ++P I L+ LR+++LS N DLK LP+++C L L++L++D C SL Sbjct: 358 LRSLNLSNCNLAEIPSSISKLIHLRQIDLSYNKDLKGLPEALCELDNLQTLNMDGCFSLV 417 Query: 259 RLPEGINHL 285 +LP G+ L Sbjct: 418 KLPRGVEKL 426 >ref|XP_002515943.1| leucine-rich repeat containing protein, putative [Ricinus communis] gi|223544848|gb|EEF46363.1| leucine-rich repeat containing protein, putative [Ricinus communis] Length = 786 Score = 65.1 bits (157), Expect = 1e-08 Identities = 30/69 (43%), Positives = 48/69 (69%) Frame = +1 Query: 79 LQTLLLPSCALVQVPIKIKNLVELRRLNLSNNVDLKELPDSICSLIELRSLDLDFCHSLR 258 L++L L +C L ++P I L+ LR+++LS N DLK LP+++C L L++L++D C SL Sbjct: 387 LRSLNLSNCNLAEIPSSICKLIHLRQIDLSYNKDLKGLPEALCELCNLQTLNMDGCFSLV 446 Query: 259 RLPEGINHL 285 +LP G+ L Sbjct: 447 KLPRGLEKL 455 >ref|XP_007217454.1| hypothetical protein PRUPE_ppb019479mg [Prunus persica] gi|462413604|gb|EMJ18653.1| hypothetical protein PRUPE_ppb019479mg [Prunus persica] Length = 761 Score = 64.7 bits (156), Expect = 1e-08 Identities = 34/69 (49%), Positives = 49/69 (71%) Frame = +1 Query: 79 LQTLLLPSCALVQVPIKIKNLVELRRLNLSNNVDLKELPDSICSLIELRSLDLDFCHSLR 258 L+TL L +L +VP ++ LV LR L+LS N DL +LPD++C+LI L++L L C +L+ Sbjct: 560 LRTLNLSHNSLKEVPNEVGELVHLRYLDLSENFDLMKLPDTMCNLINLQTLRLIRCWALK 619 Query: 259 RLPEGINHL 285 RLPEG+ L Sbjct: 620 RLPEGMGKL 628