BLASTX nr result
ID: Mentha27_contig00042506
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha27_contig00042506 (291 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EYU21228.1| hypothetical protein MIMGU_mgv1a023092mg, partial... 57 3e-06 >gb|EYU21228.1| hypothetical protein MIMGU_mgv1a023092mg, partial [Mimulus guttatus] Length = 920 Score = 57.0 bits (136), Expect = 3e-06 Identities = 32/74 (43%), Positives = 39/74 (52%) Frame = +1 Query: 4 GCSGSDGATVNSKSLSADSFKGXXXXXXXXXXXXXXXXXXKFMYENRSILTSTASTKHKI 183 GC G D + S+ L+ DSFKG F+YEN+ IL+S AS K K+ Sbjct: 798 GCPGGDRTVITSERLTTDSFKGLFLIAGLSSTTALTIFLSIFLYENQVILSSGASIKEKL 857 Query: 184 QVLTRAFYQKKNVT 225 L RAF QKKNVT Sbjct: 858 IGLGRAFCQKKNVT 871