BLASTX nr result
ID: Mentha27_contig00036978
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha27_contig00036978 (904 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value emb|CAZ40333.1| hypothetical protein [Raphanus sativus] 69 5e-10 >emb|CAZ40333.1| hypothetical protein [Raphanus sativus] Length = 785 Score = 68.6 bits (166), Expect(2) = 5e-10 Identities = 35/72 (48%), Positives = 45/72 (62%), Gaps = 6/72 (8%) Frame = +3 Query: 525 TSVCEVLYEVGDFVWAILRNDRFPAHEYNKLVTHN*IGHMEIVECINLNTY------HLC 686 T CE+++E GD VW L +R P +YNKL + +G +E+VE IN N Y HL Sbjct: 690 TKRCELIFEPGDLVWVYLTKERLPLRDYNKLKSKK-LGPVEVVERINPNVYRVRLPSHLR 748 Query: 687 TSDVFNVKHLLP 722 TSDVFN+KHL P Sbjct: 749 TSDVFNIKHLSP 760 Score = 22.7 bits (47), Expect(2) = 5e-10 Identities = 10/18 (55%), Positives = 13/18 (72%) Frame = +2 Query: 374 FEVMYGFVPRGDLWIITS 427 F V+YG VPRG L + T+ Sbjct: 632 FCVVYGIVPRGPLDLSTA 649