BLASTX nr result
ID: Mentha27_contig00014996
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha27_contig00014996 (243 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_004159116.1| PREDICTED: wall-associated receptor kinase 2... 56 6e-06 ref|XP_004144294.1| PREDICTED: uncharacterized protein LOC101209... 56 6e-06 >ref|XP_004159116.1| PREDICTED: wall-associated receptor kinase 2-like [Cucumis sativus] Length = 624 Score = 55.8 bits (133), Expect = 6e-06 Identities = 22/38 (57%), Positives = 27/38 (71%) Frame = -1 Query: 114 CESGFEGNPYIVKGCSDFDECRDATLNDCSSHNGTCVN 1 C GF+GNPY+ +GC D DEC+D TLN C +N CVN Sbjct: 267 CLEGFQGNPYLPQGCQDIDECKDETLNQC-KYNSKCVN 303 >ref|XP_004144294.1| PREDICTED: uncharacterized protein LOC101209380 [Cucumis sativus] Length = 1706 Score = 55.8 bits (133), Expect = 6e-06 Identities = 22/38 (57%), Positives = 27/38 (71%) Frame = -1 Query: 114 CESGFEGNPYIVKGCSDFDECRDATLNDCSSHNGTCVN 1 C GF+GNPY+ +GC D DEC+D TLN C +N CVN Sbjct: 267 CLEGFQGNPYLPQGCQDIDECKDETLNQC-KYNSKCVN 303