BLASTX nr result
ID: Mentha27_contig00014595
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha27_contig00014595 (287 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EYU38146.1| hypothetical protein MIMGU_mgv1a018623mg [Mimulus... 71 1e-10 gb|EPS72563.1| hypothetical protein M569_02199, partial [Genlise... 64 3e-08 ref|XP_007050650.1| Outer envelope membrane protein 7 [Theobroma... 58 2e-06 ref|XP_002306767.1| outer envelope membrane family protein [Popu... 57 3e-06 ref|XP_006366976.1| PREDICTED: uncharacterized protein LOC102601... 56 6e-06 >gb|EYU38146.1| hypothetical protein MIMGU_mgv1a018623mg [Mimulus guttatus] Length = 77 Score = 71.2 bits (173), Expect = 1e-10 Identities = 34/40 (85%), Positives = 37/40 (92%) Frame = -1 Query: 173 MAKQNSTKSAAIVFGALAFGWLAIEMALKPWLVKARSAMN 54 MAK +S KSA IVFGALAFGWLAIE+ALKPWLVKARSAM+ Sbjct: 1 MAKSSSAKSAGIVFGALAFGWLAIELALKPWLVKARSAMD 40 >gb|EPS72563.1| hypothetical protein M569_02199, partial [Genlisea aurea] Length = 62 Score = 63.5 bits (153), Expect = 3e-08 Identities = 30/40 (75%), Positives = 33/40 (82%) Frame = -1 Query: 173 MAKQNSTKSAAIVFGALAFGWLAIEMALKPWLVKARSAMN 54 M K N KSAAIV GALAFGWLAIE+ALKPWL K RSA++ Sbjct: 1 MGKSNPVKSAAIVAGALAFGWLAIELALKPWLAKVRSAID 40 >ref|XP_007050650.1| Outer envelope membrane protein 7 [Theobroma cacao] gi|508702911|gb|EOX94807.1| Outer envelope membrane protein 7 [Theobroma cacao] Length = 91 Score = 57.8 bits (138), Expect = 2e-06 Identities = 28/40 (70%), Positives = 32/40 (80%) Frame = -1 Query: 173 MAKQNSTKSAAIVFGALAFGWLAIEMALKPWLVKARSAMN 54 M K + K AA+VFGALAFGWLAIEMA KP L KAR+AM+ Sbjct: 1 MGKSTAMKQAAVVFGALAFGWLAIEMAFKPILDKARAAMD 40 >ref|XP_002306767.1| outer envelope membrane family protein [Populus trichocarpa] gi|222856216|gb|EEE93763.1| outer envelope membrane family protein [Populus trichocarpa] Length = 77 Score = 56.6 bits (135), Expect = 3e-06 Identities = 27/33 (81%), Positives = 30/33 (90%) Frame = -1 Query: 152 KSAAIVFGALAFGWLAIEMALKPWLVKARSAMN 54 K AA+VFGALAFGWLAIEMA KP+L KARSAM+ Sbjct: 7 KQAAVVFGALAFGWLAIEMAFKPFLDKARSAMD 39 >ref|XP_006366976.1| PREDICTED: uncharacterized protein LOC102601376 [Solanum tuberosum] Length = 72 Score = 55.8 bits (133), Expect = 6e-06 Identities = 27/40 (67%), Positives = 31/40 (77%) Frame = -1 Query: 173 MAKQNSTKSAAIVFGALAFGWLAIEMALKPWLVKARSAMN 54 M K NS KS A+V GALA GWLAIE A KP+L KAR+A+N Sbjct: 1 MTKANSLKSTAVVVGALACGWLAIEFAFKPFLEKARAALN 40