BLASTX nr result
ID: Mentha27_contig00012986
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha27_contig00012986 (1125 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_007035064.1| 2-oxoglutarate (2OG) and Fe(II)-dependent ox... 58 8e-06 >ref|XP_007035064.1| 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein, putative isoform 1 [Theobroma cacao] gi|508714093|gb|EOY05990.1| 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein, putative isoform 1 [Theobroma cacao] Length = 369 Score = 57.8 bits (138), Expect = 8e-06 Identities = 27/31 (87%), Positives = 29/31 (93%) Frame = +1 Query: 976 QLISNDKFRSVEHRVLANNEGPRISVACF*T 1068 QLI+NDKF+SVEHRVLAN EGPRISVACF T Sbjct: 286 QLITNDKFKSVEHRVLANREGPRISVACFFT 316