BLASTX nr result
ID: Mentha27_contig00006708
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha27_contig00006708 (329 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EYU24443.1| hypothetical protein MIMGU_mgv1a001705mg [Mimulus... 64 2e-08 >gb|EYU24443.1| hypothetical protein MIMGU_mgv1a001705mg [Mimulus guttatus] Length = 770 Score = 63.9 bits (154), Expect = 2e-08 Identities = 29/63 (46%), Positives = 40/63 (63%) Frame = -1 Query: 329 PDPSAMPEHYSPIHHSPESRKSGVENNAKNESVKENNVKSTSDNNGNSSVVARRERPSRA 150 PDPS P+H+ PIH +K+ +NN +E++K ++ G SS+V RRERPSRA Sbjct: 17 PDPSTGPDHFGPIH-----QKTRAQNNTNSENIKNGGAAVDNNGGGGSSLVVRRERPSRA 71 Query: 149 CTQ 141 CTQ Sbjct: 72 CTQ 74