BLASTX nr result
ID: Mentha27_contig00006619
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha27_contig00006619 (687 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EYU44759.1| hypothetical protein MIMGU_mgv1a014490mg [Mimulus... 76 1e-11 ref|XP_006853861.1| hypothetical protein AMTR_s00036p00109340 [A... 74 3e-11 ref|XP_003537765.2| PREDICTED: 50S ribosomal protein L12, chloro... 72 1e-10 ref|XP_003540558.1| PREDICTED: 50S ribosomal protein L12, chloro... 72 1e-10 ref|XP_006338571.1| PREDICTED: 50S ribosomal protein L12, chloro... 72 2e-10 ref|XP_006338570.1| PREDICTED: 50S ribosomal protein L12, chloro... 72 2e-10 gb|EPS63726.1| hypothetical protein M569_11058 [Genlisea aurea] 72 2e-10 ref|XP_004232304.1| PREDICTED: 50S ribosomal protein L12, chloro... 72 2e-10 ref|XP_004232303.1| PREDICTED: 50S ribosomal protein L12, chloro... 72 2e-10 sp|P36688.1|RK12_NICSY RecName: Full=50S ribosomal protein L12, ... 72 2e-10 sp|P24929.1|RK12_TOBAC RecName: Full=50S ribosomal protein L12, ... 72 2e-10 emb|CAA44226.1| ribosomal protein L12-1a [Nicotiana tabacum] 72 2e-10 emb|CBI34907.3| unnamed protein product [Vitis vinifera] 72 2e-10 ref|XP_002277258.1| PREDICTED: 50S ribosomal protein L12, chloro... 72 2e-10 gb|EXC20300.1| 50S ribosomal protein L12-1 [Morus notabilis] 71 4e-10 ref|XP_006446522.1| hypothetical protein CICLE_v10016852mg [Citr... 71 4e-10 ref|XP_004304630.1| PREDICTED: 50S ribosomal protein L12, chloro... 70 7e-10 ref|XP_002298536.1| 50S ribosomal protein L12-2 [Populus trichoc... 70 7e-10 ref|XP_007031492.1| Ribosomal protein L12-A [Theobroma cacao] gi... 70 8e-10 ref|XP_004141094.1| PREDICTED: 50S ribosomal protein L12, chloro... 70 8e-10 >gb|EYU44759.1| hypothetical protein MIMGU_mgv1a014490mg [Mimulus guttatus] Length = 188 Score = 75.9 bits (185), Expect = 1e-11 Identities = 38/40 (95%), Positives = 40/40 (100%) Frame = +1 Query: 1 VPSNMRIATIKVVRALTNLALKEAKELIEGLPKKFKEGIS 120 VPSNMRIATIKVVRALT+LALKEAKELIEGLPKKFKEG+S Sbjct: 128 VPSNMRIATIKVVRALTSLALKEAKELIEGLPKKFKEGVS 167 >ref|XP_006853861.1| hypothetical protein AMTR_s00036p00109340 [Amborella trichopoda] gi|548857529|gb|ERN15328.1| hypothetical protein AMTR_s00036p00109340 [Amborella trichopoda] Length = 152 Score = 74.3 bits (181), Expect = 3e-11 Identities = 37/40 (92%), Positives = 40/40 (100%) Frame = +1 Query: 1 VPSNMRIATIKVVRALTNLALKEAKELIEGLPKKFKEGIS 120 VPSN+RIATIKVVRALTNLALKEAK+LIEGLPKKF+EGIS Sbjct: 92 VPSNVRIATIKVVRALTNLALKEAKDLIEGLPKKFREGIS 131 >ref|XP_003537765.2| PREDICTED: 50S ribosomal protein L12, chloroplastic-like [Glycine max] Length = 233 Score = 72.4 bits (176), Expect = 1e-10 Identities = 37/40 (92%), Positives = 37/40 (92%) Frame = +1 Query: 1 VPSNMRIATIKVVRALTNLALKEAKELIEGLPKKFKEGIS 120 VPSN RIA IK VRALTNLALKEAKELIEGLPKKFKEGIS Sbjct: 173 VPSNARIAVIKAVRALTNLALKEAKELIEGLPKKFKEGIS 212 >ref|XP_003540558.1| PREDICTED: 50S ribosomal protein L12, chloroplastic-like [Glycine max] Length = 190 Score = 72.4 bits (176), Expect = 1e-10 Identities = 37/40 (92%), Positives = 37/40 (92%) Frame = +1 Query: 1 VPSNMRIATIKVVRALTNLALKEAKELIEGLPKKFKEGIS 120 VPSN RIA IK VRALTNLALKEAKELIEGLPKKFKEGIS Sbjct: 130 VPSNARIAVIKAVRALTNLALKEAKELIEGLPKKFKEGIS 169 >ref|XP_006338571.1| PREDICTED: 50S ribosomal protein L12, chloroplastic-like [Solanum tuberosum] Length = 190 Score = 72.0 bits (175), Expect = 2e-10 Identities = 36/40 (90%), Positives = 38/40 (95%) Frame = +1 Query: 1 VPSNMRIATIKVVRALTNLALKEAKELIEGLPKKFKEGIS 120 VPSN RIATIK VRALT+LALKEAKELIEGLPKKFKEG+S Sbjct: 130 VPSNARIATIKAVRALTSLALKEAKELIEGLPKKFKEGVS 169 >ref|XP_006338570.1| PREDICTED: 50S ribosomal protein L12, chloroplastic-like [Solanum tuberosum] Length = 190 Score = 72.0 bits (175), Expect = 2e-10 Identities = 36/40 (90%), Positives = 38/40 (95%) Frame = +1 Query: 1 VPSNMRIATIKVVRALTNLALKEAKELIEGLPKKFKEGIS 120 VPSN RIATIK VRALT+LALKEAKELIEGLPKKFKEG+S Sbjct: 130 VPSNARIATIKAVRALTSLALKEAKELIEGLPKKFKEGVS 169 >gb|EPS63726.1| hypothetical protein M569_11058 [Genlisea aurea] Length = 196 Score = 72.0 bits (175), Expect = 2e-10 Identities = 36/40 (90%), Positives = 38/40 (95%) Frame = +1 Query: 1 VPSNMRIATIKVVRALTNLALKEAKELIEGLPKKFKEGIS 120 VPSN RIATIKVVRALTNLALKEAK+LIEGLPKKFKE +S Sbjct: 136 VPSNARIATIKVVRALTNLALKEAKDLIEGLPKKFKEAVS 175 >ref|XP_004232304.1| PREDICTED: 50S ribosomal protein L12, chloroplastic-like [Solanum lycopersicum] Length = 190 Score = 72.0 bits (175), Expect = 2e-10 Identities = 36/40 (90%), Positives = 38/40 (95%) Frame = +1 Query: 1 VPSNMRIATIKVVRALTNLALKEAKELIEGLPKKFKEGIS 120 VPSN RIATIK VRALT+LALKEAKELIEGLPKKFKEG+S Sbjct: 130 VPSNARIATIKAVRALTSLALKEAKELIEGLPKKFKEGVS 169 >ref|XP_004232303.1| PREDICTED: 50S ribosomal protein L12, chloroplastic-like [Solanum lycopersicum] Length = 186 Score = 72.0 bits (175), Expect = 2e-10 Identities = 36/40 (90%), Positives = 38/40 (95%) Frame = +1 Query: 1 VPSNMRIATIKVVRALTNLALKEAKELIEGLPKKFKEGIS 120 VPSN RIATIK VRALT+LALKEAKELIEGLPKKFKEG+S Sbjct: 126 VPSNARIATIKAVRALTSLALKEAKELIEGLPKKFKEGVS 165 >sp|P36688.1|RK12_NICSY RecName: Full=50S ribosomal protein L12, chloroplastic; AltName: Full=CL12; Flags: Precursor gi|248303|gb|AAB21989.1| ribosomal protein L12 [Nicotiana sylvestris] Length = 186 Score = 72.0 bits (175), Expect = 2e-10 Identities = 36/40 (90%), Positives = 38/40 (95%) Frame = +1 Query: 1 VPSNMRIATIKVVRALTNLALKEAKELIEGLPKKFKEGIS 120 VPSN RIATIK VRALT+LALKEAKELIEGLPKKFKEG+S Sbjct: 126 VPSNARIATIKAVRALTSLALKEAKELIEGLPKKFKEGVS 165 >sp|P24929.1|RK12_TOBAC RecName: Full=50S ribosomal protein L12, chloroplastic; AltName: Full=CL12; Flags: Precursor gi|20018|emb|CAA44214.1| ribosomal protein L12-1 [Nicotiana tabacum] Length = 186 Score = 72.0 bits (175), Expect = 2e-10 Identities = 36/40 (90%), Positives = 38/40 (95%) Frame = +1 Query: 1 VPSNMRIATIKVVRALTNLALKEAKELIEGLPKKFKEGIS 120 VPSN RIATIK VRALT+LALKEAKELIEGLPKKFKEG+S Sbjct: 126 VPSNARIATIKAVRALTSLALKEAKELIEGLPKKFKEGVS 165 >emb|CAA44226.1| ribosomal protein L12-1a [Nicotiana tabacum] Length = 191 Score = 72.0 bits (175), Expect = 2e-10 Identities = 36/40 (90%), Positives = 38/40 (95%) Frame = +1 Query: 1 VPSNMRIATIKVVRALTNLALKEAKELIEGLPKKFKEGIS 120 VPSN RIATIK VRALT+LALKEAKELIEGLPKKFKEG+S Sbjct: 126 VPSNARIATIKAVRALTSLALKEAKELIEGLPKKFKEGVS 165 >emb|CBI34907.3| unnamed protein product [Vitis vinifera] Length = 144 Score = 72.0 bits (175), Expect = 2e-10 Identities = 36/40 (90%), Positives = 38/40 (95%) Frame = +1 Query: 1 VPSNMRIATIKVVRALTNLALKEAKELIEGLPKKFKEGIS 120 VPSN RIATIK VRALT+LALKEAKELIEGLPKKFKEG+S Sbjct: 84 VPSNARIATIKAVRALTSLALKEAKELIEGLPKKFKEGVS 123 >ref|XP_002277258.1| PREDICTED: 50S ribosomal protein L12, chloroplastic [Vitis vinifera] Length = 184 Score = 72.0 bits (175), Expect = 2e-10 Identities = 36/40 (90%), Positives = 38/40 (95%) Frame = +1 Query: 1 VPSNMRIATIKVVRALTNLALKEAKELIEGLPKKFKEGIS 120 VPSN RIATIK VRALT+LALKEAKELIEGLPKKFKEG+S Sbjct: 124 VPSNARIATIKAVRALTSLALKEAKELIEGLPKKFKEGVS 163 >gb|EXC20300.1| 50S ribosomal protein L12-1 [Morus notabilis] Length = 193 Score = 70.9 bits (172), Expect = 4e-10 Identities = 35/40 (87%), Positives = 38/40 (95%) Frame = +1 Query: 1 VPSNMRIATIKVVRALTNLALKEAKELIEGLPKKFKEGIS 120 VPSN+RIA IK VRALT+LALKEAKELIEGLPKKFKEG+S Sbjct: 133 VPSNVRIAVIKAVRALTSLALKEAKELIEGLPKKFKEGVS 172 >ref|XP_006446522.1| hypothetical protein CICLE_v10016852mg [Citrus clementina] gi|557549133|gb|ESR59762.1| hypothetical protein CICLE_v10016852mg [Citrus clementina] Length = 188 Score = 70.9 bits (172), Expect = 4e-10 Identities = 35/40 (87%), Positives = 37/40 (92%) Frame = +1 Query: 1 VPSNMRIATIKVVRALTNLALKEAKELIEGLPKKFKEGIS 120 VPSN RIA IK VRALTNLALKEAK+LIEGLPKKFKEG+S Sbjct: 128 VPSNARIAVIKAVRALTNLALKEAKDLIEGLPKKFKEGVS 167 >ref|XP_004304630.1| PREDICTED: 50S ribosomal protein L12, chloroplastic-like [Fragaria vesca subsp. vesca] Length = 187 Score = 70.1 bits (170), Expect = 7e-10 Identities = 35/40 (87%), Positives = 37/40 (92%) Frame = +1 Query: 1 VPSNMRIATIKVVRALTNLALKEAKELIEGLPKKFKEGIS 120 VPSN RIA IK VRALT+LALKEAKELIEGLPKKFKEG+S Sbjct: 127 VPSNARIAVIKAVRALTSLALKEAKELIEGLPKKFKEGVS 166 >ref|XP_002298536.1| 50S ribosomal protein L12-2 [Populus trichocarpa] gi|118483906|gb|ABK93843.1| unknown [Populus trichocarpa] gi|222845794|gb|EEE83341.1| 50S ribosomal protein L12-2 [Populus trichocarpa] Length = 187 Score = 70.1 bits (170), Expect = 7e-10 Identities = 35/40 (87%), Positives = 38/40 (95%) Frame = +1 Query: 1 VPSNMRIATIKVVRALTNLALKEAKELIEGLPKKFKEGIS 120 VPSN+RIA IK VRALT+LALKEAKELIEGLPKKFKEG+S Sbjct: 127 VPSNVRIAVIKSVRALTSLALKEAKELIEGLPKKFKEGVS 166 >ref|XP_007031492.1| Ribosomal protein L12-A [Theobroma cacao] gi|508710521|gb|EOY02418.1| Ribosomal protein L12-A [Theobroma cacao] Length = 192 Score = 69.7 bits (169), Expect = 8e-10 Identities = 34/40 (85%), Positives = 37/40 (92%) Frame = +1 Query: 1 VPSNMRIATIKVVRALTNLALKEAKELIEGLPKKFKEGIS 120 VPSN RIA IK VR+LTNLALKEAK+LIEGLPKKFKEG+S Sbjct: 132 VPSNARIAVIKAVRSLTNLALKEAKDLIEGLPKKFKEGVS 171 >ref|XP_004141094.1| PREDICTED: 50S ribosomal protein L12, chloroplastic-like [Cucumis sativus] Length = 191 Score = 69.7 bits (169), Expect = 8e-10 Identities = 36/40 (90%), Positives = 37/40 (92%) Frame = +1 Query: 1 VPSNMRIATIKVVRALTNLALKEAKELIEGLPKKFKEGIS 120 VPSN RIA IK VRALT+LALKEAKELIEGLPKKFKEGIS Sbjct: 131 VPSNARIAVIKSVRALTSLALKEAKELIEGLPKKFKEGIS 170