BLASTX nr result
ID: Mentha27_contig00005440
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha27_contig00005440 (231 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EYU35924.1| hypothetical protein MIMGU_mgv1a026548mg [Mimulus... 62 8e-08 gb|EYU35923.1| hypothetical protein MIMGU_mgv1a024353mg, partial... 60 3e-07 gb|EYU31380.1| hypothetical protein MIMGU_mgv1a023932mg [Mimulus... 59 5e-07 gb|EYU31379.1| hypothetical protein MIMGU_mgv1a020154mg [Mimulus... 59 5e-07 gb|EYU31382.1| hypothetical protein MIMGU_mgv1a018210mg [Mimulus... 59 9e-07 gb|EYU35922.1| hypothetical protein MIMGU_mgv1a025427mg, partial... 58 2e-06 gb|EYU31383.1| hypothetical protein MIMGU_mgv1a019288mg [Mimulus... 57 2e-06 >gb|EYU35924.1| hypothetical protein MIMGU_mgv1a026548mg [Mimulus guttatus] Length = 1004 Score = 62.0 bits (149), Expect = 8e-08 Identities = 27/46 (58%), Positives = 36/46 (78%) Frame = -3 Query: 139 WIYVLLSLGYAVGFSGVCSVLVLKKS*RDAYFGFAEKICDKLYVYF 2 W+YV +SLGYAVG S C+ L+ KKS R+AYF F E++ +K+YVYF Sbjct: 947 WLYVFVSLGYAVGLSIFCTTLIFKKSWREAYFEFMEEMWNKVYVYF 992 >gb|EYU35923.1| hypothetical protein MIMGU_mgv1a024353mg, partial [Mimulus guttatus] Length = 962 Score = 60.1 bits (144), Expect = 3e-07 Identities = 26/46 (56%), Positives = 35/46 (76%) Frame = -3 Query: 139 WIYVLLSLGYAVGFSGVCSVLVLKKS*RDAYFGFAEKICDKLYVYF 2 W+YV +SLGYAVG S C++L+ KKS R+AY+ F E I ++ YVYF Sbjct: 902 WLYVFVSLGYAVGLSVFCTMLIFKKSWREAYYEFMEDIWNRAYVYF 947 >gb|EYU31380.1| hypothetical protein MIMGU_mgv1a023932mg [Mimulus guttatus] Length = 964 Score = 59.3 bits (142), Expect = 5e-07 Identities = 26/46 (56%), Positives = 35/46 (76%) Frame = -3 Query: 139 WIYVLLSLGYAVGFSGVCSVLVLKKS*RDAYFGFAEKICDKLYVYF 2 W YV +S GYAVG S C+ L+LKKS R+AYF F E++ +++YVYF Sbjct: 907 WFYVFVSSGYAVGLSIFCTTLILKKSWREAYFEFMEEMWNRVYVYF 952 >gb|EYU31379.1| hypothetical protein MIMGU_mgv1a020154mg [Mimulus guttatus] Length = 214 Score = 59.3 bits (142), Expect = 5e-07 Identities = 28/46 (60%), Positives = 31/46 (67%) Frame = -3 Query: 139 WIYVLLSLGYAVGFSGVCSVLVLKKS*RDAYFGFAEKICDKLYVYF 2 W YV LSLGYA GFS C+ LVL KS R AYFG E IC++ Y F Sbjct: 162 WFYVFLSLGYAAGFSIFCTTLVLNKSWRVAYFGLVEDICNRAYYGF 207 >gb|EYU31382.1| hypothetical protein MIMGU_mgv1a018210mg [Mimulus guttatus] Length = 949 Score = 58.5 bits (140), Expect = 9e-07 Identities = 25/46 (54%), Positives = 35/46 (76%) Frame = -3 Query: 139 WIYVLLSLGYAVGFSGVCSVLVLKKS*RDAYFGFAEKICDKLYVYF 2 W+YV +SLGYAVG S C+ L+ KKS R+AYF E++ +++YVYF Sbjct: 892 WLYVFVSLGYAVGLSIFCTTLIFKKSWREAYFELMEEMWNRVYVYF 937 >gb|EYU35922.1| hypothetical protein MIMGU_mgv1a025427mg, partial [Mimulus guttatus] Length = 905 Score = 57.8 bits (138), Expect = 2e-06 Identities = 24/46 (52%), Positives = 35/46 (76%) Frame = -3 Query: 139 WIYVLLSLGYAVGFSGVCSVLVLKKS*RDAYFGFAEKICDKLYVYF 2 W+YV +S GYAVG S C+ L+ KKS R+AY+ F E++ +++YVYF Sbjct: 848 WLYVFVSSGYAVGLSVFCTTLIFKKSWREAYYKFMEEMWNRVYVYF 893 >gb|EYU31383.1| hypothetical protein MIMGU_mgv1a019288mg [Mimulus guttatus] Length = 929 Score = 57.4 bits (137), Expect = 2e-06 Identities = 25/45 (55%), Positives = 32/45 (71%) Frame = -3 Query: 139 WIYVLLSLGYAVGFSGVCSVLVLKKS*RDAYFGFAEKICDKLYVY 5 W +V LSLGY GFS VC+ L L K R+AYFGF E I +++Y+Y Sbjct: 872 WYFVFLSLGYGFGFSVVCTTLALNKLWREAYFGFLENIWNRIYLY 916