BLASTX nr result
ID: Mentha27_contig00005378
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha27_contig00005378 (401 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EYU21263.1| hypothetical protein MIMGU_mgv1a003152mg [Mimulus... 69 9e-10 gb|EYU45920.1| hypothetical protein MIMGU_mgv1a003936mg [Mimulus... 67 2e-09 >gb|EYU21263.1| hypothetical protein MIMGU_mgv1a003152mg [Mimulus guttatus] Length = 604 Score = 68.6 bits (166), Expect = 9e-10 Identities = 38/64 (59%), Positives = 45/64 (70%), Gaps = 7/64 (10%) Frame = +1 Query: 229 MPLLDIAISQPCSCFLNNIIAFRSEIGLRKRIVIGNDR------RVVLASTFSGRNFC-T 387 MPLLDIAISQPCSCF NNI+ FRSE R R+V+GND+ + LAS+FS R+ C T Sbjct: 1 MPLLDIAISQPCSCFRNNILPFRSENHFRNRLVLGNDKGLGLGLGLGLASSFSWRSSCIT 60 Query: 388 GEVG 399 G G Sbjct: 61 GREG 64 >gb|EYU45920.1| hypothetical protein MIMGU_mgv1a003936mg [Mimulus guttatus] Length = 553 Score = 67.4 bits (163), Expect = 2e-09 Identities = 31/55 (56%), Positives = 40/55 (72%) Frame = +1 Query: 229 MPLLDIAISQPCSCFLNNIIAFRSEIGLRKRIVIGNDRRVVLASTFSGRNFCTGE 393 MPLLDIA SQ CSCFLNNI+AFR++ RI++ NDR + L + FS ++FC E Sbjct: 1 MPLLDIATSQACSCFLNNILAFRTKPNFHNRILVKNDRVLELGTAFSWKSFCVTE 55