BLASTX nr result
ID: Mentha27_contig00005274
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha27_contig00005274 (246 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EYU29928.1| hypothetical protein MIMGU_mgv1a001694mg [Mimulus... 59 7e-07 gb|EYU29922.1| hypothetical protein MIMGU_mgv1a0259201mg, partia... 58 2e-06 gb|EYU29513.1| hypothetical protein MIMGU_mgv1a025475mg [Mimulus... 57 3e-06 >gb|EYU29928.1| hypothetical protein MIMGU_mgv1a001694mg [Mimulus guttatus] Length = 772 Score = 58.9 bits (141), Expect = 7e-07 Identities = 32/65 (49%), Positives = 42/65 (64%), Gaps = 5/65 (7%) Frame = +3 Query: 3 IYLPHPPLN---KGRDDLFLCENLQSLKLIMNLRLSEEVCNIIPNIKKLHLVYH--DKLQ 167 IYLP P + + D+ + NLQ+LK ++NLRLSEEVC IPNIK LH+ YH L+ Sbjct: 532 IYLPEPHSSCDQQDEDEFIVLRNLQTLKKVVNLRLSEEVCKRIPNIKILHMEYHPQSSLR 591 Query: 168 GYDDS 182 DD+ Sbjct: 592 ESDDT 596 >gb|EYU29922.1| hypothetical protein MIMGU_mgv1a0259201mg, partial [Mimulus guttatus] Length = 778 Score = 57.8 bits (138), Expect = 2e-06 Identities = 29/53 (54%), Positives = 37/53 (69%), Gaps = 1/53 (1%) Frame = +3 Query: 3 IYLPHPPLNKGR-DDLFLCENLQSLKLIMNLRLSEEVCNIIPNIKKLHLVYHD 158 +YLP PPL DD+ + +NL + K +NL+LSEEVC IPNIKKL L+Y D Sbjct: 521 MYLPDPPLRSQEIDDVIVLKNLHTFKGAVNLKLSEEVCKRIPNIKKLKLLYPD 573 >gb|EYU29513.1| hypothetical protein MIMGU_mgv1a025475mg [Mimulus guttatus] Length = 873 Score = 57.0 bits (136), Expect = 3e-06 Identities = 29/55 (52%), Positives = 39/55 (70%), Gaps = 1/55 (1%) Frame = +3 Query: 3 IYLPHPPL-NKGRDDLFLCENLQSLKLIMNLRLSEEVCNIIPNIKKLHLVYHDKL 164 IYLP PPL ++ DD + +NL +LK +MNL+LSEEVC IPN+K L + Y + L Sbjct: 600 IYLPDPPLRSEQNDDGIVLKNLHTLKKVMNLKLSEEVCTRIPNVKILKIKYIEDL 654