BLASTX nr result
ID: Mentha27_contig00005268
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha27_contig00005268 (235 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EYU39678.1| hypothetical protein MIMGU_mgv1a003888mg [Mimulus... 63 4e-08 >gb|EYU39678.1| hypothetical protein MIMGU_mgv1a003888mg [Mimulus guttatus] Length = 557 Score = 63.2 bits (152), Expect = 4e-08 Identities = 28/37 (75%), Positives = 35/37 (94%) Frame = +2 Query: 5 GRAFALAGMSSHASQRATTRGSLVAGAAPPADSFAFG 115 GRA+AL+GMSSH +QRATT+G LVAGAAPPA++F+FG Sbjct: 478 GRAYALSGMSSHRTQRATTKGKLVAGAAPPAENFSFG 514