BLASTX nr result
ID: Mentha27_contig00005250
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha27_contig00005250 (608 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_004244103.1| PREDICTED: uncharacterized protein LOC101243... 58 2e-06 >ref|XP_004244103.1| PREDICTED: uncharacterized protein LOC101243908 [Solanum lycopersicum] Length = 116 Score = 57.8 bits (138), Expect = 2e-06 Identities = 30/54 (55%), Positives = 36/54 (66%), Gaps = 1/54 (1%) Frame = -3 Query: 474 RALPYPVLLATTAPP-GGKLSVLLQTGGVCLIAYWVANFVVPGIVLKDLQSKAT 316 R L P L A +P G LSVLLQTG V L YW+ANFVVP ++KDLQ ++T Sbjct: 51 RNLLIPPLKAVNSPATSGDLSVLLQTGAVMLFIYWIANFVVPEFIMKDLQDEST 104