BLASTX nr result
ID: Mentha27_contig00005223
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha27_contig00005223 (1624 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EYU40753.1| hypothetical protein MIMGU_mgv1a014536mg [Mimulus... 68 8e-09 >gb|EYU40753.1| hypothetical protein MIMGU_mgv1a014536mg [Mimulus guttatus] Length = 186 Score = 68.2 bits (165), Expect(2) = 8e-09 Identities = 32/59 (54%), Positives = 41/59 (69%), Gaps = 2/59 (3%) Frame = +1 Query: 799 PRNNDNGGHNFDLDLNT--RSGPPLPAQKPKEKPPNRVWPKLTPNLLLSDAGIGHLFRY 969 P + N +N D N+ + PPLP QKPK+KPP R PKLTP+LLLSD+G+GH+ RY Sbjct: 33 PNSEINNNNNADPPSNSDFSAKPPLPNQKPKQKPPRRTRPKLTPDLLLSDSGVGHILRY 91 Score = 20.4 bits (41), Expect(2) = 8e-09 Identities = 7/8 (87%), Positives = 7/8 (87%) Frame = +3 Query: 984 KCRGCGHE 1007 KCRG GHE Sbjct: 97 KCRGRGHE 104