BLASTX nr result
ID: Mentha27_contig00005102
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha27_contig00005102 (544 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_004300171.1| PREDICTED: secretory carrier-associated memb... 105 6e-21 ref|XP_002303454.1| secretory carrier membrane family protein [P... 105 6e-21 ref|XP_007158207.1| hypothetical protein PHAVU_002G133200g [Phas... 105 1e-20 ref|NP_001241252.1| uncharacterized protein LOC100806586 [Glycin... 104 1e-20 ref|XP_006415261.1| hypothetical protein EUTSA_v10008500mg [Eutr... 103 2e-20 ref|XP_006304101.1| hypothetical protein CARUB_v10010029mg [Caps... 103 3e-20 ref|XP_004146111.1| PREDICTED: secretory carrier-associated memb... 103 3e-20 ref|NP_174485.1| secretory carrier-associated membrane protein 5... 103 3e-20 ref|XP_002890966.1| secretory carrier membrane protein family pr... 103 3e-20 dbj|BAH20435.1| AT1G32050 [Arabidopsis thaliana] 103 3e-20 dbj|BAH20345.1| AT1G32050 [Arabidopsis thaliana] 103 3e-20 dbj|BAH03477.1| secretory carrier-associated membrane protein 2 ... 103 3e-20 ref|NP_001241214.1| uncharacterized protein LOC100780723 [Glycin... 103 4e-20 gb|ACU18292.1| unknown [Glycine max] 103 4e-20 ref|XP_004512452.1| PREDICTED: secretory carrier-associated memb... 102 5e-20 gb|AFK41920.1| unknown [Lotus japonicus] 101 1e-19 ref|XP_003612685.1| Secretory carrier-associated membrane protei... 101 1e-19 gb|EYU23286.1| hypothetical protein MIMGU_mgv1a011911mg [Mimulus... 101 1e-19 ref|XP_006368326.1| secretory carrier membrane family protein [P... 101 1e-19 ref|XP_006368327.1| hypothetical protein POPTR_0001s01640g [Popu... 101 1e-19 >ref|XP_004300171.1| PREDICTED: secretory carrier-associated membrane protein 4-like [Fragaria vesca subsp. vesca] Length = 263 Score = 105 bits (263), Expect = 6e-21 Identities = 51/57 (89%), Positives = 53/57 (92%) Frame = -1 Query: 544 IVFHGKSLTGILAAIDVFSDNALAGIFYLIGFALFCLESLLSLWVLQKIYVYFRGNK 374 IVF GKSLTGILAAIDVFSD+ + GIFYLIGFALFCLESLLS WVLQKIYVYFRGNK Sbjct: 207 IVFQGKSLTGILAAIDVFSDHVIVGIFYLIGFALFCLESLLSFWVLQKIYVYFRGNK 263 >ref|XP_002303454.1| secretory carrier membrane family protein [Populus trichocarpa] gi|118486235|gb|ABK94959.1| unknown [Populus trichocarpa] gi|222840886|gb|EEE78433.1| secretory carrier membrane family protein [Populus trichocarpa] Length = 270 Score = 105 bits (263), Expect = 6e-21 Identities = 49/57 (85%), Positives = 53/57 (92%) Frame = -1 Query: 544 IVFHGKSLTGILAAIDVFSDNALAGIFYLIGFALFCLESLLSLWVLQKIYVYFRGNK 374 IVFHGKSLTGIL A+DVFSD+ L GIFYL+GF LFCLESLLSLWVLQKIY+YFRGNK Sbjct: 214 IVFHGKSLTGILPAVDVFSDHVLVGIFYLVGFGLFCLESLLSLWVLQKIYMYFRGNK 270 >ref|XP_007158207.1| hypothetical protein PHAVU_002G133200g [Phaseolus vulgaris] gi|561031622|gb|ESW30201.1| hypothetical protein PHAVU_002G133200g [Phaseolus vulgaris] Length = 262 Score = 105 bits (261), Expect = 1e-20 Identities = 49/57 (85%), Positives = 54/57 (94%) Frame = -1 Query: 544 IVFHGKSLTGILAAIDVFSDNALAGIFYLIGFALFCLESLLSLWVLQKIYVYFRGNK 374 +VFHGKSLTGILAAIDVFSD+ L GIFYLIGF LFCLE+LLSLWVLQKIY+YFRG+K Sbjct: 206 VVFHGKSLTGILAAIDVFSDHVLVGIFYLIGFGLFCLEALLSLWVLQKIYMYFRGHK 262 >ref|NP_001241252.1| uncharacterized protein LOC100806586 [Glycine max] gi|255638153|gb|ACU19390.1| unknown [Glycine max] Length = 269 Score = 104 bits (260), Expect = 1e-20 Identities = 49/57 (85%), Positives = 54/57 (94%) Frame = -1 Query: 544 IVFHGKSLTGILAAIDVFSDNALAGIFYLIGFALFCLESLLSLWVLQKIYVYFRGNK 374 IVFHGKSLTGILAAIDVFSD+ L GIFYLIGF +FCLE+LLSLWVLQKIY+YFRG+K Sbjct: 213 IVFHGKSLTGILAAIDVFSDHVLVGIFYLIGFGMFCLEALLSLWVLQKIYMYFRGHK 269 >ref|XP_006415261.1| hypothetical protein EUTSA_v10008500mg [Eutrema salsugineum] gi|567145492|ref|XP_006415262.1| hypothetical protein EUTSA_v10008500mg [Eutrema salsugineum] gi|557093032|gb|ESQ33614.1| hypothetical protein EUTSA_v10008500mg [Eutrema salsugineum] gi|557093033|gb|ESQ33615.1| hypothetical protein EUTSA_v10008500mg [Eutrema salsugineum] Length = 264 Score = 103 bits (258), Expect = 2e-20 Identities = 49/57 (85%), Positives = 52/57 (91%) Frame = -1 Query: 544 IVFHGKSLTGILAAIDVFSDNALAGIFYLIGFALFCLESLLSLWVLQKIYVYFRGNK 374 I FHGKSLTG+LAAIDV SD+ LAGIFY IGF LFCLESLLSLWVLQKIY+YFRGNK Sbjct: 208 IFFHGKSLTGVLAAIDVISDSVLAGIFYFIGFGLFCLESLLSLWVLQKIYLYFRGNK 264 >ref|XP_006304101.1| hypothetical protein CARUB_v10010029mg [Capsella rubella] gi|482572812|gb|EOA36999.1| hypothetical protein CARUB_v10010029mg [Capsella rubella] Length = 265 Score = 103 bits (257), Expect = 3e-20 Identities = 49/57 (85%), Positives = 52/57 (91%) Frame = -1 Query: 544 IVFHGKSLTGILAAIDVFSDNALAGIFYLIGFALFCLESLLSLWVLQKIYVYFRGNK 374 I FHGKSLTG+LAAIDV SD+ LAGIFY IGF LFCLESLLSLWVLQKIY+YFRGNK Sbjct: 209 IFFHGKSLTGVLAAIDVMSDSLLAGIFYFIGFGLFCLESLLSLWVLQKIYLYFRGNK 265 >ref|XP_004146111.1| PREDICTED: secretory carrier-associated membrane protein 4-like [Cucumis sativus] Length = 269 Score = 103 bits (257), Expect = 3e-20 Identities = 48/57 (84%), Positives = 53/57 (92%) Frame = -1 Query: 544 IVFHGKSLTGILAAIDVFSDNALAGIFYLIGFALFCLESLLSLWVLQKIYVYFRGNK 374 +VFHG+SLTGILAAIDVFS++ L GIFYLIGF FCLESLLSLWVLQKIY+YFRGNK Sbjct: 213 VVFHGQSLTGILAAIDVFSEHVLVGIFYLIGFGFFCLESLLSLWVLQKIYLYFRGNK 269 >ref|NP_174485.1| secretory carrier-associated membrane protein 5 [Arabidopsis thaliana] gi|75169200|sp|Q9C6X2.1|SCAM4_ARATH RecName: Full=Secretory carrier-associated membrane protein 4; Short=Secretory carrier membrane protein 4 gi|12321473|gb|AAG50798.1|AC074309_15 secretory carrier membrane protein, putative [Arabidopsis thaliana] gi|21592989|gb|AAM64938.1| secretory carrier membrane protein, putative [Arabidopsis thaliana] gi|107738363|gb|ABF83683.1| At1g32050 [Arabidopsis thaliana] gi|110741518|dbj|BAE98709.1| hypothetical protein [Arabidopsis thaliana] gi|332193308|gb|AEE31429.1| secretory carrier-associated membrane protein 4 [Arabidopsis thaliana] Length = 264 Score = 103 bits (257), Expect = 3e-20 Identities = 49/57 (85%), Positives = 52/57 (91%) Frame = -1 Query: 544 IVFHGKSLTGILAAIDVFSDNALAGIFYLIGFALFCLESLLSLWVLQKIYVYFRGNK 374 I FHGKSLTG+LAAIDV SD+ LAGIFY IGF LFCLESLLSLWVLQKIY+YFRGNK Sbjct: 208 IFFHGKSLTGVLAAIDVISDSLLAGIFYFIGFGLFCLESLLSLWVLQKIYLYFRGNK 264 >ref|XP_002890966.1| secretory carrier membrane protein family protein [Arabidopsis lyrata subsp. lyrata] gi|297336808|gb|EFH67225.1| secretory carrier membrane protein family protein [Arabidopsis lyrata subsp. lyrata] Length = 264 Score = 103 bits (257), Expect = 3e-20 Identities = 49/57 (85%), Positives = 52/57 (91%) Frame = -1 Query: 544 IVFHGKSLTGILAAIDVFSDNALAGIFYLIGFALFCLESLLSLWVLQKIYVYFRGNK 374 I FHGKSLTG+LAAIDV SD+ LAGIFY IGF LFCLESLLSLWVLQKIY+YFRGNK Sbjct: 208 IFFHGKSLTGVLAAIDVISDSLLAGIFYFIGFGLFCLESLLSLWVLQKIYLYFRGNK 264 >dbj|BAH20435.1| AT1G32050 [Arabidopsis thaliana] Length = 230 Score = 103 bits (257), Expect = 3e-20 Identities = 49/57 (85%), Positives = 52/57 (91%) Frame = -1 Query: 544 IVFHGKSLTGILAAIDVFSDNALAGIFYLIGFALFCLESLLSLWVLQKIYVYFRGNK 374 I FHGKSLTG+LAAIDV SD+ LAGIFY IGF LFCLESLLSLWVLQKIY+YFRGNK Sbjct: 174 IFFHGKSLTGVLAAIDVISDSLLAGIFYFIGFGLFCLESLLSLWVLQKIYLYFRGNK 230 >dbj|BAH20345.1| AT1G32050 [Arabidopsis thaliana] Length = 264 Score = 103 bits (257), Expect = 3e-20 Identities = 49/57 (85%), Positives = 52/57 (91%) Frame = -1 Query: 544 IVFHGKSLTGILAAIDVFSDNALAGIFYLIGFALFCLESLLSLWVLQKIYVYFRGNK 374 I FHGKSLTG+LAAIDV SD+ LAGIFY IGF LFCLESLLSLWVLQKIY+YFRGNK Sbjct: 208 IFFHGKSLTGVLAAIDVISDSLLAGIFYFIGFGLFCLESLLSLWVLQKIYLYFRGNK 264 >dbj|BAH03477.1| secretory carrier-associated membrane protein 2 [Nicotiana tabacum] Length = 271 Score = 103 bits (257), Expect = 3e-20 Identities = 48/57 (84%), Positives = 54/57 (94%) Frame = -1 Query: 544 IVFHGKSLTGILAAIDVFSDNALAGIFYLIGFALFCLESLLSLWVLQKIYVYFRGNK 374 IVFHGKSLTGILAAIDVFSD+ L GIFYLIGFA FCLE+LLSLWVLQK+Y++FRG+K Sbjct: 215 IVFHGKSLTGILAAIDVFSDHVLVGIFYLIGFAFFCLEALLSLWVLQKVYMFFRGHK 271 >ref|NP_001241214.1| uncharacterized protein LOC100780723 [Glycine max] gi|255641378|gb|ACU20966.1| unknown [Glycine max] Length = 269 Score = 103 bits (256), Expect = 4e-20 Identities = 48/57 (84%), Positives = 53/57 (92%) Frame = -1 Query: 544 IVFHGKSLTGILAAIDVFSDNALAGIFYLIGFALFCLESLLSLWVLQKIYVYFRGNK 374 IVFHGKSLTGILAAIDVFSD+ L GIFYLIGF +FCLE+LLS WVLQKIY+YFRG+K Sbjct: 213 IVFHGKSLTGILAAIDVFSDHVLVGIFYLIGFGMFCLEALLSFWVLQKIYMYFRGHK 269 >gb|ACU18292.1| unknown [Glycine max] Length = 88 Score = 103 bits (256), Expect = 4e-20 Identities = 48/57 (84%), Positives = 53/57 (92%) Frame = -1 Query: 544 IVFHGKSLTGILAAIDVFSDNALAGIFYLIGFALFCLESLLSLWVLQKIYVYFRGNK 374 IVFHGKSLTGILAAIDVFSD+ L GIFYLIGF +FCLE+LLS WVLQKIY+YFRG+K Sbjct: 32 IVFHGKSLTGILAAIDVFSDHVLVGIFYLIGFGMFCLEALLSFWVLQKIYMYFRGHK 88 >ref|XP_004512452.1| PREDICTED: secretory carrier-associated membrane protein 4-like [Cicer arietinum] Length = 267 Score = 102 bits (255), Expect = 5e-20 Identities = 47/57 (82%), Positives = 54/57 (94%) Frame = -1 Query: 544 IVFHGKSLTGILAAIDVFSDNALAGIFYLIGFALFCLESLLSLWVLQKIYVYFRGNK 374 +VFHGKSLTGILAAIDVFSD+ L GIFYLIGF LFCLE+LLSLWV+QKIY++FRG+K Sbjct: 211 VVFHGKSLTGILAAIDVFSDHVLVGIFYLIGFGLFCLEALLSLWVIQKIYMFFRGHK 267 >gb|AFK41920.1| unknown [Lotus japonicus] Length = 268 Score = 101 bits (252), Expect = 1e-19 Identities = 46/57 (80%), Positives = 53/57 (92%) Frame = -1 Query: 544 IVFHGKSLTGILAAIDVFSDNALAGIFYLIGFALFCLESLLSLWVLQKIYVYFRGNK 374 +VFHGKSLTGILAA DVFSD+ L GIFYL+GF LFCLESLLSLWV+QKIY++FRG+K Sbjct: 212 VVFHGKSLTGILAATDVFSDHVLVGIFYLVGFGLFCLESLLSLWVIQKIYLFFRGHK 268 >ref|XP_003612685.1| Secretory carrier-associated membrane protein [Medicago truncatula] gi|355514020|gb|AES95643.1| Secretory carrier-associated membrane protein [Medicago truncatula] Length = 267 Score = 101 bits (252), Expect = 1e-19 Identities = 46/57 (80%), Positives = 54/57 (94%) Frame = -1 Query: 544 IVFHGKSLTGILAAIDVFSDNALAGIFYLIGFALFCLESLLSLWVLQKIYVYFRGNK 374 +VFHGKSLTGILAAIDVFSD+ L GIFYLIGF LFCLE+LLSLWV+Q+IY++FRG+K Sbjct: 211 VVFHGKSLTGILAAIDVFSDHVLVGIFYLIGFGLFCLEALLSLWVIQRIYMFFRGHK 267 >gb|EYU23286.1| hypothetical protein MIMGU_mgv1a011911mg [Mimulus guttatus] Length = 267 Score = 101 bits (251), Expect = 1e-19 Identities = 47/57 (82%), Positives = 51/57 (89%) Frame = -1 Query: 544 IVFHGKSLTGILAAIDVFSDNALAGIFYLIGFALFCLESLLSLWVLQKIYVYFRGNK 374 IVF G+SLTGILAAIDVFSD+ L GIFYL+GF FCLESLLSLWVLQK+Y YFRGNK Sbjct: 211 IVFQGRSLTGILAAIDVFSDHVLVGIFYLLGFGFFCLESLLSLWVLQKVYAYFRGNK 267 >ref|XP_006368326.1| secretory carrier membrane family protein [Populus trichocarpa] gi|550346231|gb|ERP64895.1| secretory carrier membrane family protein [Populus trichocarpa] Length = 269 Score = 101 bits (251), Expect = 1e-19 Identities = 47/57 (82%), Positives = 52/57 (91%) Frame = -1 Query: 544 IVFHGKSLTGILAAIDVFSDNALAGIFYLIGFALFCLESLLSLWVLQKIYVYFRGNK 374 IVFHGKSLTGIL A+DV SD+ L GIFYL+GF LFCLESLLSLWVLQKIY+YFRG+K Sbjct: 213 IVFHGKSLTGILPAVDVISDHLLVGIFYLVGFGLFCLESLLSLWVLQKIYMYFRGHK 269 >ref|XP_006368327.1| hypothetical protein POPTR_0001s01640g [Populus trichocarpa] gi|118482846|gb|ABK93338.1| unknown [Populus trichocarpa] gi|550346232|gb|ERP64896.1| hypothetical protein POPTR_0001s01640g [Populus trichocarpa] Length = 270 Score = 101 bits (251), Expect = 1e-19 Identities = 47/57 (82%), Positives = 52/57 (91%) Frame = -1 Query: 544 IVFHGKSLTGILAAIDVFSDNALAGIFYLIGFALFCLESLLSLWVLQKIYVYFRGNK 374 IVFHGKSLTGIL A+DV SD+ L GIFYL+GF LFCLESLLSLWVLQKIY+YFRG+K Sbjct: 214 IVFHGKSLTGILPAVDVISDHLLVGIFYLVGFGLFCLESLLSLWVLQKIYMYFRGHK 270