BLASTX nr result
ID: Mentha27_contig00005038
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha27_contig00005038 (494 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_004170252.1| PREDICTED: UPF0496 protein 4-like isoform 1 ... 64 2e-08 gb|EYU36842.1| hypothetical protein MIMGU_mgv1a022117mg [Mimulus... 63 4e-08 emb|CBI18207.3| unnamed protein product [Vitis vinifera] 62 6e-08 ref|XP_002267096.1| PREDICTED: uncharacterized protein LOC100257... 62 6e-08 ref|XP_004139685.1| PREDICTED: UPF0496 protein 4-like [Cucumis s... 62 1e-07 ref|XP_006359811.1| PREDICTED: uncharacterized protein LOC102586... 61 2e-07 ref|XP_004237794.1| PREDICTED: uncharacterized protein LOC101243... 61 2e-07 gb|EXC19889.1| hypothetical protein L484_017866 [Morus notabilis] 60 3e-07 ref|XP_002306699.1| hypothetical protein POPTR_0005s21470g [Popu... 59 9e-07 ref|XP_002524287.1| conserved hypothetical protein [Ricinus comm... 58 2e-06 ref|XP_006434464.1| hypothetical protein CICLE_v10001440mg [Citr... 57 2e-06 ref|XP_003592100.1| hypothetical protein MTR_1g098700 [Medicago ... 57 2e-06 gb|EPS70879.1| hypothetical protein M569_03877, partial [Genlise... 57 3e-06 ref|NP_565086.1| uncharacterized protein [Arabidopsis thaliana] ... 57 3e-06 gb|AAM61006.1| unknown [Arabidopsis thaliana] 57 3e-06 ref|XP_006390424.1| hypothetical protein EUTSA_v10018683mg [Eutr... 57 3e-06 ref|XP_004496468.1| PREDICTED: uncharacterized protein LOC101494... 57 3e-06 ref|XP_002302176.1| hypothetical protein POPTR_0002s06840g [Popu... 57 3e-06 ref|XP_007143541.1| hypothetical protein PHAVU_007G080200g [Phas... 56 6e-06 ref|XP_004160313.1| PREDICTED: protein BPS1, chloroplastic-like ... 56 6e-06 >ref|XP_004170252.1| PREDICTED: UPF0496 protein 4-like isoform 1 [Cucumis sativus] gi|449526503|ref|XP_004170253.1| PREDICTED: UPF0496 protein 4-like isoform 2 [Cucumis sativus] Length = 394 Score = 64.3 bits (155), Expect = 2e-08 Identities = 29/39 (74%), Positives = 33/39 (84%) Frame = -1 Query: 491 EAIKVGLDPLERLIREVFRRIVRSRTEGLDTIGRANAHD 375 E +K+GLDPLER IREVF RIVRSRTEGLD +GR N H+ Sbjct: 356 ETLKIGLDPLERQIREVFHRIVRSRTEGLDCLGRGNTHE 394 >gb|EYU36842.1| hypothetical protein MIMGU_mgv1a022117mg [Mimulus guttatus] Length = 392 Score = 63.2 bits (152), Expect = 4e-08 Identities = 29/37 (78%), Positives = 33/37 (89%) Frame = -1 Query: 494 YEAIKVGLDPLERLIREVFRRIVRSRTEGLDTIGRAN 384 YEAIK GLDP ER +R+VF RIVRSRTEGLD++GRAN Sbjct: 354 YEAIKYGLDPFEREVRDVFHRIVRSRTEGLDSVGRAN 390 >emb|CBI18207.3| unnamed protein product [Vitis vinifera] Length = 611 Score = 62.4 bits (150), Expect = 6e-08 Identities = 29/36 (80%), Positives = 32/36 (88%) Frame = -1 Query: 491 EAIKVGLDPLERLIREVFRRIVRSRTEGLDTIGRAN 384 + IK GLDPLER +REVF RIVRSRTEGLDT+GRAN Sbjct: 567 QTIKAGLDPLERQVREVFHRIVRSRTEGLDTLGRAN 602 >ref|XP_002267096.1| PREDICTED: uncharacterized protein LOC100257198 isoform 1 [Vitis vinifera] gi|359493118|ref|XP_003634513.1| PREDICTED: uncharacterized protein LOC100257198 isoform 2 [Vitis vinifera] Length = 387 Score = 62.4 bits (150), Expect = 6e-08 Identities = 29/36 (80%), Positives = 32/36 (88%) Frame = -1 Query: 491 EAIKVGLDPLERLIREVFRRIVRSRTEGLDTIGRAN 384 + IK GLDPLER +REVF RIVRSRTEGLDT+GRAN Sbjct: 350 QTIKAGLDPLERQVREVFHRIVRSRTEGLDTLGRAN 385 >ref|XP_004139685.1| PREDICTED: UPF0496 protein 4-like [Cucumis sativus] Length = 394 Score = 61.6 bits (148), Expect = 1e-07 Identities = 28/39 (71%), Positives = 32/39 (82%) Frame = -1 Query: 491 EAIKVGLDPLERLIREVFRRIVRSRTEGLDTIGRANAHD 375 E +K+GLDPLER IREVF RIVRSRTEGLD +G N H+ Sbjct: 356 ETLKIGLDPLERQIREVFHRIVRSRTEGLDCLGGGNTHE 394 >ref|XP_006359811.1| PREDICTED: uncharacterized protein LOC102586098 [Solanum tuberosum] Length = 388 Score = 60.8 bits (146), Expect = 2e-07 Identities = 28/37 (75%), Positives = 32/37 (86%) Frame = -1 Query: 494 YEAIKVGLDPLERLIREVFRRIVRSRTEGLDTIGRAN 384 Y+ +K GLDPLER +REVF RIVRSRTEGLD+IGR N Sbjct: 350 YDGLKNGLDPLERQVREVFHRIVRSRTEGLDSIGRGN 386 >ref|XP_004237794.1| PREDICTED: uncharacterized protein LOC101243886 [Solanum lycopersicum] Length = 388 Score = 60.8 bits (146), Expect = 2e-07 Identities = 28/37 (75%), Positives = 32/37 (86%) Frame = -1 Query: 494 YEAIKVGLDPLERLIREVFRRIVRSRTEGLDTIGRAN 384 Y+ +K GLDPLER +REVF RIVRSRTEGLD+IGR N Sbjct: 350 YDGLKNGLDPLERQVREVFHRIVRSRTEGLDSIGRGN 386 >gb|EXC19889.1| hypothetical protein L484_017866 [Morus notabilis] Length = 372 Score = 60.1 bits (144), Expect = 3e-07 Identities = 27/36 (75%), Positives = 33/36 (91%) Frame = -1 Query: 491 EAIKVGLDPLERLIREVFRRIVRSRTEGLDTIGRAN 384 EA++ GLDPLER +R+VF RIVRSRTEGLD++GRAN Sbjct: 334 EALRYGLDPLERQVRDVFHRIVRSRTEGLDSLGRAN 369 >ref|XP_002306699.1| hypothetical protein POPTR_0005s21470g [Populus trichocarpa] gi|222856148|gb|EEE93695.1| hypothetical protein POPTR_0005s21470g [Populus trichocarpa] Length = 389 Score = 58.5 bits (140), Expect = 9e-07 Identities = 27/36 (75%), Positives = 31/36 (86%) Frame = -1 Query: 491 EAIKVGLDPLERLIREVFRRIVRSRTEGLDTIGRAN 384 E +K GLDPLER +REVF RIVRSRTEGLD++GR N Sbjct: 352 EVLKEGLDPLERQVREVFHRIVRSRTEGLDSLGRPN 387 >ref|XP_002524287.1| conserved hypothetical protein [Ricinus communis] gi|223536378|gb|EEF38027.1| conserved hypothetical protein [Ricinus communis] Length = 402 Score = 57.8 bits (138), Expect = 2e-06 Identities = 26/39 (66%), Positives = 32/39 (82%) Frame = -1 Query: 491 EAIKVGLDPLERLIREVFRRIVRSRTEGLDTIGRANAHD 375 + +K GLDPLER +REVF RIV SRTEGLD++GR N +D Sbjct: 364 DVMKEGLDPLERQVREVFHRIVHSRTEGLDSLGRVNQND 402 >ref|XP_006434464.1| hypothetical protein CICLE_v10001440mg [Citrus clementina] gi|557536586|gb|ESR47704.1| hypothetical protein CICLE_v10001440mg [Citrus clementina] Length = 390 Score = 57.4 bits (137), Expect = 2e-06 Identities = 26/40 (65%), Positives = 33/40 (82%) Frame = -1 Query: 494 YEAIKVGLDPLERLIREVFRRIVRSRTEGLDTIGRANAHD 375 +E+IK GLDPLE +REVF +IVRSRTEGLD++G+ N D Sbjct: 351 FESIKGGLDPLEGQVREVFHKIVRSRTEGLDSLGKGNGPD 390 >ref|XP_003592100.1| hypothetical protein MTR_1g098700 [Medicago truncatula] gi|355481148|gb|AES62351.1| hypothetical protein MTR_1g098700 [Medicago truncatula] Length = 405 Score = 57.4 bits (137), Expect = 2e-06 Identities = 26/36 (72%), Positives = 32/36 (88%) Frame = -1 Query: 491 EAIKVGLDPLERLIREVFRRIVRSRTEGLDTIGRAN 384 +A+K GLDPLER +REVF RIVRS+TEGLD++GR N Sbjct: 368 DALKDGLDPLERQVREVFHRIVRSKTEGLDSLGRPN 403 >gb|EPS70879.1| hypothetical protein M569_03877, partial [Genlisea aurea] Length = 383 Score = 57.0 bits (136), Expect = 3e-06 Identities = 26/32 (81%), Positives = 30/32 (93%) Frame = -1 Query: 494 YEAIKVGLDPLERLIREVFRRIVRSRTEGLDT 399 +EA+K+GLDPLER IR+VFRRIVRSR EGLDT Sbjct: 352 HEAVKIGLDPLERQIRDVFRRIVRSRVEGLDT 383 >ref|NP_565086.1| uncharacterized protein [Arabidopsis thaliana] gi|12324802|gb|AAG52364.1|AC011765_16 unknown protein; 39057-40250 [Arabidopsis thaliana] gi|16226874|gb|AAL16287.1|AF428357_1 At1g74450/F1M20_13 [Arabidopsis thaliana] gi|18176416|gb|AAL60040.1| unknown protein [Arabidopsis thaliana] gi|22136856|gb|AAM91772.1| unknown protein [Arabidopsis thaliana] gi|332197473|gb|AEE35594.1| uncharacterized protein AT1G74450 [Arabidopsis thaliana] Length = 397 Score = 57.0 bits (136), Expect = 3e-06 Identities = 26/34 (76%), Positives = 30/34 (88%) Frame = -1 Query: 491 EAIKVGLDPLERLIREVFRRIVRSRTEGLDTIGR 390 EA+K GLDP ER +REVF RIVRSRTEGLDT+G+ Sbjct: 359 EALKNGLDPFERKVREVFHRIVRSRTEGLDTVGK 392 >gb|AAM61006.1| unknown [Arabidopsis thaliana] Length = 397 Score = 57.0 bits (136), Expect = 3e-06 Identities = 26/34 (76%), Positives = 30/34 (88%) Frame = -1 Query: 491 EAIKVGLDPLERLIREVFRRIVRSRTEGLDTIGR 390 EA+K GLDP ER +REVF RIVRSRTEGLDT+G+ Sbjct: 359 EALKNGLDPFERKVREVFHRIVRSRTEGLDTVGK 392 >ref|XP_006390424.1| hypothetical protein EUTSA_v10018683mg [Eutrema salsugineum] gi|557086858|gb|ESQ27710.1| hypothetical protein EUTSA_v10018683mg [Eutrema salsugineum] Length = 391 Score = 56.6 bits (135), Expect = 3e-06 Identities = 26/36 (72%), Positives = 31/36 (86%) Frame = -1 Query: 491 EAIKVGLDPLERLIREVFRRIVRSRTEGLDTIGRAN 384 EA+K GLDP ER +REVF RIVRSRTEGLD++G A+ Sbjct: 356 EALKNGLDPFERKVREVFHRIVRSRTEGLDSVGNAS 391 >ref|XP_004496468.1| PREDICTED: uncharacterized protein LOC101494271 [Cicer arietinum] Length = 400 Score = 56.6 bits (135), Expect = 3e-06 Identities = 26/34 (76%), Positives = 31/34 (91%) Frame = -1 Query: 491 EAIKVGLDPLERLIREVFRRIVRSRTEGLDTIGR 390 +A+K GLDPLER +REVF RIVRSRTEGLD++GR Sbjct: 362 DALKDGLDPLERQVREVFHRIVRSRTEGLDSLGR 395 >ref|XP_002302176.1| hypothetical protein POPTR_0002s06840g [Populus trichocarpa] gi|222843902|gb|EEE81449.1| hypothetical protein POPTR_0002s06840g [Populus trichocarpa] Length = 390 Score = 56.6 bits (135), Expect = 3e-06 Identities = 26/36 (72%), Positives = 30/36 (83%) Frame = -1 Query: 491 EAIKVGLDPLERLIREVFRRIVRSRTEGLDTIGRAN 384 E +K GLDPLER +REVF RIV SRTEGLD++GR N Sbjct: 353 EVLKEGLDPLERQVREVFHRIVHSRTEGLDSLGRPN 388 >ref|XP_007143541.1| hypothetical protein PHAVU_007G080200g [Phaseolus vulgaris] gi|561016731|gb|ESW15535.1| hypothetical protein PHAVU_007G080200g [Phaseolus vulgaris] Length = 404 Score = 55.8 bits (133), Expect = 6e-06 Identities = 26/34 (76%), Positives = 31/34 (91%) Frame = -1 Query: 491 EAIKVGLDPLERLIREVFRRIVRSRTEGLDTIGR 390 +A+K GLDPLER +R+VF RIVRSRTEGLD+IGR Sbjct: 366 DALKDGLDPLERKVRKVFHRIVRSRTEGLDSIGR 399 >ref|XP_004160313.1| PREDICTED: protein BPS1, chloroplastic-like [Cucumis sativus] Length = 391 Score = 55.8 bits (133), Expect = 6e-06 Identities = 25/36 (69%), Positives = 31/36 (86%) Frame = -1 Query: 491 EAIKVGLDPLERLIREVFRRIVRSRTEGLDTIGRAN 384 + ++ GLD LER +REVF RIVRSRTEGLD++GRAN Sbjct: 353 DTLRTGLDSLERQVREVFHRIVRSRTEGLDSLGRAN 388