BLASTX nr result
ID: Mentha27_contig00002563
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha27_contig00002563 (302 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|NP_001152559.1| membrane protein [Zea mays] gi|195657471|gb|... 59 9e-07 ref|XP_004239222.1| PREDICTED: stress-associated endoplasmic ret... 58 1e-06 ref|XP_004239220.1| PREDICTED: stress-associated endoplasmic ret... 58 1e-06 ref|XP_007223936.1| hypothetical protein PRUPE_ppa014280mg [Prun... 58 2e-06 gb|ABA99116.2| Ribosome associated membrane protein RAMP4 contai... 57 3e-06 gb|AAW23953.1| predicted membrane protein 3 [Brassica juncea] 56 5e-06 gb|AAT08724.1| unknown [Hyacinthus orientalis] 55 8e-06 >ref|NP_001152559.1| membrane protein [Zea mays] gi|195657471|gb|ACG48203.1| membrane protein [Zea mays] gi|413941997|gb|AFW74646.1| membrane protein [Zea mays] Length = 67 Score = 58.5 bits (140), Expect = 9e-07 Identities = 25/31 (80%), Positives = 29/31 (93%) Frame = +1 Query: 1 PETTAKKANNYPVGPILLGFFIFVVIGSCNN 93 PETT KK+N+YPVGPI+LGFFIFVVIGSC + Sbjct: 26 PETTVKKSNDYPVGPIVLGFFIFVVIGSCKH 56 >ref|XP_004239222.1| PREDICTED: stress-associated endoplasmic reticulum protein 2-like isoform 3 [Solanum lycopersicum] Length = 73 Score = 58.2 bits (139), Expect = 1e-06 Identities = 28/41 (68%), Positives = 32/41 (78%) Frame = +1 Query: 1 PETTAKKANNYPVGPILLGFFIFVVIGSCNNYFSSHLISSH 123 PETTAKK + YPVGPILLGFF+FVVIGSC + HL S+ Sbjct: 26 PETTAKKGSQYPVGPILLGFFVFVVIGSCKIFV--HLFVSN 64 >ref|XP_004239220.1| PREDICTED: stress-associated endoplasmic reticulum protein 2-like isoform 1 [Solanum lycopersicum] Length = 93 Score = 58.2 bits (139), Expect = 1e-06 Identities = 28/41 (68%), Positives = 32/41 (78%) Frame = +1 Query: 1 PETTAKKANNYPVGPILLGFFIFVVIGSCNNYFSSHLISSH 123 PETTAKK + YPVGPILLGFF+FVVIGSC + HL S+ Sbjct: 46 PETTAKKGSQYPVGPILLGFFVFVVIGSCKIFV--HLFVSN 84 >ref|XP_007223936.1| hypothetical protein PRUPE_ppa014280mg [Prunus persica] gi|462420872|gb|EMJ25135.1| hypothetical protein PRUPE_ppa014280mg [Prunus persica] Length = 76 Score = 57.8 bits (138), Expect = 2e-06 Identities = 25/29 (86%), Positives = 27/29 (93%) Frame = +1 Query: 1 PETTAKKANNYPVGPILLGFFIFVVIGSC 87 PETTAKK +YPVGPILLGFF+FVVIGSC Sbjct: 26 PETTAKKGKDYPVGPILLGFFVFVVIGSC 54 >gb|ABA99116.2| Ribosome associated membrane protein RAMP4 containing protein, expressed [Oryza sativa Japonica Group] Length = 66 Score = 56.6 bits (135), Expect = 3e-06 Identities = 24/29 (82%), Positives = 27/29 (93%) Frame = +1 Query: 1 PETTAKKANNYPVGPILLGFFIFVVIGSC 87 PETT KK N+YPVGP++LGFFIFVVIGSC Sbjct: 26 PETTVKKGNDYPVGPMVLGFFIFVVIGSC 54 >gb|AAW23953.1| predicted membrane protein 3 [Brassica juncea] Length = 51 Score = 56.2 bits (134), Expect = 5e-06 Identities = 24/29 (82%), Positives = 26/29 (89%) Frame = +1 Query: 1 PETTAKKANNYPVGPILLGFFIFVVIGSC 87 PETT KK +YPVGPILLGFF+FVVIGSC Sbjct: 20 PETTTKKGKDYPVGPILLGFFVFVVIGSC 48 >gb|AAT08724.1| unknown [Hyacinthus orientalis] Length = 85 Score = 55.5 bits (132), Expect = 8e-06 Identities = 25/28 (89%), Positives = 26/28 (92%) Frame = +1 Query: 1 PETTAKKANNYPVGPILLGFFIFVVIGS 84 PETT KK N+YPVGPILLGFFIFVVIGS Sbjct: 43 PETTVKKGNDYPVGPILLGFFIFVVIGS 70