BLASTX nr result
ID: Mentha27_contig00002084
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha27_contig00002084 (755 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EYU18977.1| hypothetical protein MIMGU_mgv1a016754mg [Mimulus... 65 3e-08 >gb|EYU18977.1| hypothetical protein MIMGU_mgv1a016754mg [Mimulus guttatus] Length = 108 Score = 65.1 bits (157), Expect = 3e-08 Identities = 35/64 (54%), Positives = 42/64 (65%), Gaps = 1/64 (1%) Frame = +3 Query: 189 MASMNMFFSPI-VTPQRRVLRXXXXXXXXXXXXXXXXXILDFILGSLTKQDQFYETDPIL 365 MAS+N+F +PI VTPQRRVLR +LDFILG L K++Q YET+PIL Sbjct: 1 MASLNLFVAPINVTPQRRVLRTAATAAKSSGGGGEEKGLLDFILGGLAKEEQIYETNPIL 60 Query: 366 KKVE 377 KKVE Sbjct: 61 KKVE 64