BLASTX nr result
ID: Mentha26_contig00048425
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha26_contig00048425 (522 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_003615432.1| hypothetical protein MTR_5g067940 [Medicago ... 74 2e-14 ref|XP_003605622.1| hypothetical protein MTR_4g035030 [Medicago ... 76 6e-12 >ref|XP_003615432.1| hypothetical protein MTR_5g067940 [Medicago truncatula] gi|355516767|gb|AES98390.1| hypothetical protein MTR_5g067940 [Medicago truncatula] Length = 69 Score = 74.3 bits (181), Expect(2) = 2e-14 Identities = 40/48 (83%), Positives = 41/48 (85%) Frame = +2 Query: 140 MAKSVDATDLIGLSLGMETY*VITFKFRETPELIKMGNPEPNPVFPKQ 283 MA+ VDATDLIGLSLGMETY V TFKFRET EL KMGNPEPNP F KQ Sbjct: 1 MAELVDATDLIGLSLGMETYQVKTFKFRETLEL-KMGNPEPNPSFRKQ 47 Score = 30.4 bits (67), Expect(2) = 2e-14 Identities = 12/18 (66%), Positives = 13/18 (72%) Frame = +1 Query: 286 VSKNKKKRIGVETQWKLF 339 + KKRIG ETQWKLF Sbjct: 52 LESENKKRIGAETQWKLF 69 >ref|XP_003605622.1| hypothetical protein MTR_4g035030 [Medicago truncatula] gi|357471517|ref|XP_003606043.1| hypothetical protein MTR_4g051230 [Medicago truncatula] gi|358349395|ref|XP_003638723.1| hypothetical protein MTR_141s0027 [Medicago truncatula] gi|355504658|gb|AES85861.1| hypothetical protein MTR_141s0027 [Medicago truncatula] gi|355506677|gb|AES87819.1| hypothetical protein MTR_4g035030 [Medicago truncatula] gi|355507098|gb|AES88240.1| hypothetical protein MTR_4g051230 [Medicago truncatula] Length = 95 Score = 75.9 bits (185), Expect = 6e-12 Identities = 41/48 (85%), Positives = 41/48 (85%) Frame = +2 Query: 140 MAKSVDATDLIGLSLGMETY*VITFKFRETPELIKMGNPEPNPVFPKQ 283 MAK VDATDLIGLSLGMETY V TFKFRET EL KMGNPEPNP F KQ Sbjct: 1 MAKLVDATDLIGLSLGMETYQVKTFKFRETLEL-KMGNPEPNPSFRKQ 47