BLASTX nr result
ID: Mentha26_contig00048140
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha26_contig00048140 (366 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EYU44410.1| hypothetical protein MIMGU_mgv1a007541mg [Mimulus... 71 1e-10 >gb|EYU44410.1| hypothetical protein MIMGU_mgv1a007541mg [Mimulus guttatus] Length = 404 Score = 71.2 bits (173), Expect = 1e-10 Identities = 34/54 (62%), Positives = 38/54 (70%) Frame = +2 Query: 2 NIAYCRANAKFGMCDVPLLAPPPPGQLSPSVQAQPPINNSPIHRPFYIHCFSST 163 NIAYCR NA FG CDVP+L+PPPP QLSP+ Q NNSPI +P Y H F T Sbjct: 345 NIAYCRVNATFGTCDVPVLSPPPPAQLSPTDQIG---NNSPISKPLYHHWFILT 395