BLASTX nr result
ID: Mentha26_contig00041679
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha26_contig00041679 (344 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EYU37397.1| hypothetical protein MIMGU_mgv1a027165mg [Mimulus... 56 6e-06 >gb|EYU37397.1| hypothetical protein MIMGU_mgv1a027165mg [Mimulus guttatus] Length = 236 Score = 55.8 bits (133), Expect = 6e-06 Identities = 32/44 (72%), Positives = 33/44 (75%) Frame = -3 Query: 132 EEVDGVEPGVCAEEDESIAAAPAVVVRTHKGLARKVLPDVMGIF 1 EE G GV A DE + AAPAVVVR HKGLARKVLPDVMGIF Sbjct: 184 EEFSG-HVGVAAPADE-LVAAPAVVVRNHKGLARKVLPDVMGIF 225