BLASTX nr result
ID: Mentha26_contig00038766
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha26_contig00038766 (383 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EYU31383.1| hypothetical protein MIMGU_mgv1a019288mg [Mimulus... 48 5e-07 >gb|EYU31383.1| hypothetical protein MIMGU_mgv1a019288mg [Mimulus guttatus] Length = 929 Score = 47.8 bits (112), Expect(2) = 5e-07 Identities = 33/85 (38%), Positives = 45/85 (52%) Frame = -1 Query: 257 PSWF*GLSVLNLSHNQFHGEILNFEPQKNHVEFPYYRWIFLSSNKFSGVLPRVSYDVIEX 78 PSW + LNLSHNQ HG I P + + +Y ++LSSN+FSG LPRV+ +V Sbjct: 472 PSWIWKVRFLNLSHNQLHGSI----PVISDIGRRHY--LYLSSNQFSGSLPRVAPNVSAL 525 Query: 77 XXXXXXXXXXXXXFVCGVTNESYGL 3 F+C + NE+Y L Sbjct: 526 DLSNNSFSGGLSHFLCEM-NETYSL 549 Score = 31.6 bits (70), Expect(2) = 5e-07 Identities = 12/24 (50%), Positives = 19/24 (79%) Frame = -2 Query: 337 KIPSWIELHRSNILVLDLSNAGLN 266 +IPSWIE+ ++ I LDLS+ G++ Sbjct: 445 EIPSWIEMQKTQIHTLDLSSTGIS 468