BLASTX nr result
ID: Mentha26_contig00035501
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha26_contig00035501 (363 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EYU34960.1| hypothetical protein MIMGU_mgv1a026890mg [Mimulus... 62 2e-19 >gb|EYU34960.1| hypothetical protein MIMGU_mgv1a026890mg [Mimulus guttatus] Length = 374 Score = 62.4 bits (150), Expect(2) = 2e-19 Identities = 34/47 (72%), Positives = 35/47 (74%) Frame = +2 Query: 53 MEERGGGVAEKMDTHHHLFKILEVLNRVSRDPQLSHDSPDCDSSAIK 193 MEER E +DTHH LFKILE LNRVS D Q SHDSPD DSSAIK Sbjct: 1 MEEREE--PETIDTHHRLFKILEALNRVSHDFQPSHDSPDSDSSAIK 45 Score = 58.9 bits (141), Expect(2) = 2e-19 Identities = 27/42 (64%), Positives = 35/42 (83%) Frame = +1 Query: 238 FSLPQRLSQLADSVEELRDSKPSRRGLVAFVTRRVRSHEVSR 363 FSL Q++S+L DSV+EL + KPS+ GL++FV RVRSHEVSR Sbjct: 59 FSLSQQISRLVDSVQELHNCKPSKHGLISFVAHRVRSHEVSR 100