BLASTX nr result
ID: Mentha26_contig00018946
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha26_contig00018946 (514 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EYU37420.1| hypothetical protein MIMGU_mgv1a0000982mg, partia... 91 2e-16 ref|XP_006355221.1| PREDICTED: DDB1- and CUL4-associated factor ... 89 5e-16 ref|XP_006355220.1| PREDICTED: DDB1- and CUL4-associated factor ... 89 5e-16 ref|XP_004246232.1| PREDICTED: DDB1- and CUL4-associated factor ... 89 5e-16 ref|XP_004305596.1| PREDICTED: DDB1- and CUL4-associated factor ... 87 2e-15 ref|XP_007137102.1| hypothetical protein PHAVU_009G099700g [Phas... 87 3e-15 ref|XP_007011479.1| DDB1-CUL4 associated factor 1 [Theobroma cac... 87 3e-15 ref|XP_006581396.1| PREDICTED: DDB1- and CUL4-associated factor ... 86 4e-15 ref|XP_006578187.1| PREDICTED: DDB1- and CUL4-associated factor ... 86 4e-15 ref|XP_006578186.1| PREDICTED: DDB1- and CUL4-associated factor ... 86 4e-15 ref|XP_004501259.1| PREDICTED: DDB1- and CUL4-associated factor ... 85 1e-14 ref|XP_007226326.1| hypothetical protein PRUPE_ppa021958mg [Prun... 84 2e-14 ref|XP_003603512.1| DDB1- and CUL4-associated factor-like protei... 84 3e-14 ref|XP_002280997.2| PREDICTED: DDB1- and CUL4-associated factor ... 83 3e-14 emb|CBI20820.3| unnamed protein product [Vitis vinifera] 83 3e-14 ref|XP_002528006.1| conserved hypothetical protein [Ricinus comm... 83 3e-14 ref|XP_004162499.1| PREDICTED: LOW QUALITY PROTEIN: DDB1- and CU... 82 6e-14 ref|XP_004136459.1| PREDICTED: DDB1- and CUL4-associated factor ... 82 6e-14 gb|EXB60457.1| DDB1- and CUL4-associated factor-1-like protein [... 82 8e-14 ref|XP_006382218.1| transducin family protein [Populus trichocar... 82 8e-14 >gb|EYU37420.1| hypothetical protein MIMGU_mgv1a0000982mg, partial [Mimulus guttatus] Length = 784 Score = 90.9 bits (224), Expect = 2e-16 Identities = 43/43 (100%), Positives = 43/43 (100%) Frame = -1 Query: 514 VDRCVLDFATEPTDSFVGLITMDDQDEMYSSARVYEIGRRKPT 386 VDRCVLDFATEPTDSFVGLITMDDQDEMYSSARVYEIGRRKPT Sbjct: 629 VDRCVLDFATEPTDSFVGLITMDDQDEMYSSARVYEIGRRKPT 671 >ref|XP_006355221.1| PREDICTED: DDB1- and CUL4-associated factor homolog 1-like isoform X2 [Solanum tuberosum] Length = 1877 Score = 89.4 bits (220), Expect = 5e-16 Identities = 41/43 (95%), Positives = 43/43 (100%) Frame = -1 Query: 514 VDRCVLDFATEPTDSFVGLITMDDQDEMYSSARVYEIGRRKPT 386 VDRCVLDFATEPTDSFVGL+TMDDQDEMYSSARVYEIGRR+PT Sbjct: 1730 VDRCVLDFATEPTDSFVGLVTMDDQDEMYSSARVYEIGRRRPT 1772 >ref|XP_006355220.1| PREDICTED: DDB1- and CUL4-associated factor homolog 1-like isoform X1 [Solanum tuberosum] Length = 1964 Score = 89.4 bits (220), Expect = 5e-16 Identities = 41/43 (95%), Positives = 43/43 (100%) Frame = -1 Query: 514 VDRCVLDFATEPTDSFVGLITMDDQDEMYSSARVYEIGRRKPT 386 VDRCVLDFATEPTDSFVGL+TMDDQDEMYSSARVYEIGRR+PT Sbjct: 1817 VDRCVLDFATEPTDSFVGLVTMDDQDEMYSSARVYEIGRRRPT 1859 >ref|XP_004246232.1| PREDICTED: DDB1- and CUL4-associated factor homolog 1-like [Solanum lycopersicum] Length = 1921 Score = 89.4 bits (220), Expect = 5e-16 Identities = 41/43 (95%), Positives = 43/43 (100%) Frame = -1 Query: 514 VDRCVLDFATEPTDSFVGLITMDDQDEMYSSARVYEIGRRKPT 386 VDRCVLDFATEPTDSFVGL+TMDDQDEMYSSARVYEIGRR+PT Sbjct: 1774 VDRCVLDFATEPTDSFVGLVTMDDQDEMYSSARVYEIGRRRPT 1816 >ref|XP_004305596.1| PREDICTED: DDB1- and CUL4-associated factor homolog 1-like [Fragaria vesca subsp. vesca] Length = 1911 Score = 87.0 bits (214), Expect = 2e-15 Identities = 40/43 (93%), Positives = 43/43 (100%) Frame = -1 Query: 514 VDRCVLDFATEPTDSFVGLITMDDQDEMYSSARVYEIGRRKPT 386 VDRCVLDFATEPTDSF+GLITMDDQDEM++SARVYEIGRRKPT Sbjct: 1759 VDRCVLDFATEPTDSFLGLITMDDQDEMFASARVYEIGRRKPT 1801 >ref|XP_007137102.1| hypothetical protein PHAVU_009G099700g [Phaseolus vulgaris] gi|561010189|gb|ESW09096.1| hypothetical protein PHAVU_009G099700g [Phaseolus vulgaris] Length = 1938 Score = 86.7 bits (213), Expect = 3e-15 Identities = 39/43 (90%), Positives = 43/43 (100%) Frame = -1 Query: 514 VDRCVLDFATEPTDSFVGLITMDDQDEMYSSARVYEIGRRKPT 386 VDRCVLDFATEPTDSFVGLITMDDQ+EMY+SAR+YEIGRR+PT Sbjct: 1783 VDRCVLDFATEPTDSFVGLITMDDQEEMYASARIYEIGRRRPT 1825 >ref|XP_007011479.1| DDB1-CUL4 associated factor 1 [Theobroma cacao] gi|508781842|gb|EOY29098.1| DDB1-CUL4 associated factor 1 [Theobroma cacao] Length = 1976 Score = 86.7 bits (213), Expect = 3e-15 Identities = 40/43 (93%), Positives = 43/43 (100%) Frame = -1 Query: 514 VDRCVLDFATEPTDSFVGLITMDDQDEMYSSARVYEIGRRKPT 386 VDRCVLDFATEPTDSFVGLITMDDQ+EM+SSARVYEIGRR+PT Sbjct: 1826 VDRCVLDFATEPTDSFVGLITMDDQEEMFSSARVYEIGRRRPT 1868 >ref|XP_006581396.1| PREDICTED: DDB1- and CUL4-associated factor homolog 1-like [Glycine max] Length = 1923 Score = 86.3 bits (212), Expect = 4e-15 Identities = 39/43 (90%), Positives = 42/43 (97%) Frame = -1 Query: 514 VDRCVLDFATEPTDSFVGLITMDDQDEMYSSARVYEIGRRKPT 386 VDRCVLDFA EPTDSFVGLITMDDQDEMY+SAR+YEIGRR+PT Sbjct: 1770 VDRCVLDFAAEPTDSFVGLITMDDQDEMYASARIYEIGRRRPT 1812 >ref|XP_006578187.1| PREDICTED: DDB1- and CUL4-associated factor homolog 1-like isoform X2 [Glycine max] gi|571449580|ref|XP_006578188.1| PREDICTED: DDB1- and CUL4-associated factor homolog 1-like isoform X3 [Glycine max] Length = 1938 Score = 86.3 bits (212), Expect = 4e-15 Identities = 39/43 (90%), Positives = 42/43 (97%) Frame = -1 Query: 514 VDRCVLDFATEPTDSFVGLITMDDQDEMYSSARVYEIGRRKPT 386 VDRCVLDFA EPTDSFVGLITMDDQDEMY+SAR+YEIGRR+PT Sbjct: 1785 VDRCVLDFAAEPTDSFVGLITMDDQDEMYASARIYEIGRRRPT 1827 >ref|XP_006578186.1| PREDICTED: DDB1- and CUL4-associated factor homolog 1-like isoform X1 [Glycine max] Length = 1941 Score = 86.3 bits (212), Expect = 4e-15 Identities = 39/43 (90%), Positives = 42/43 (97%) Frame = -1 Query: 514 VDRCVLDFATEPTDSFVGLITMDDQDEMYSSARVYEIGRRKPT 386 VDRCVLDFA EPTDSFVGLITMDDQDEMY+SAR+YEIGRR+PT Sbjct: 1788 VDRCVLDFAAEPTDSFVGLITMDDQDEMYASARIYEIGRRRPT 1830 >ref|XP_004501259.1| PREDICTED: DDB1- and CUL4-associated factor homolog 1-like [Cicer arietinum] Length = 1944 Score = 84.7 bits (208), Expect = 1e-14 Identities = 40/43 (93%), Positives = 41/43 (95%) Frame = -1 Query: 514 VDRCVLDFATEPTDSFVGLITMDDQDEMYSSARVYEIGRRKPT 386 VDRCVLDFATEPTDSFVGLITMDDQ EMYSSAR YEIGRR+PT Sbjct: 1794 VDRCVLDFATEPTDSFVGLITMDDQGEMYSSARSYEIGRRRPT 1836 >ref|XP_007226326.1| hypothetical protein PRUPE_ppa021958mg [Prunus persica] gi|462423262|gb|EMJ27525.1| hypothetical protein PRUPE_ppa021958mg [Prunus persica] Length = 1837 Score = 84.3 bits (207), Expect = 2e-14 Identities = 39/43 (90%), Positives = 42/43 (97%) Frame = -1 Query: 514 VDRCVLDFATEPTDSFVGLITMDDQDEMYSSARVYEIGRRKPT 386 VDRCVLDFATEPTDSFVGLITMDDQD+M +SARVYEIGRR+PT Sbjct: 1685 VDRCVLDFATEPTDSFVGLITMDDQDDMLASARVYEIGRRRPT 1727 >ref|XP_003603512.1| DDB1- and CUL4-associated factor-like protein [Medicago truncatula] gi|355492560|gb|AES73763.1| DDB1- and CUL4-associated factor-like protein [Medicago truncatula] Length = 805 Score = 83.6 bits (205), Expect = 3e-14 Identities = 39/43 (90%), Positives = 41/43 (95%) Frame = -1 Query: 514 VDRCVLDFATEPTDSFVGLITMDDQDEMYSSARVYEIGRRKPT 386 VDRCVLDFATEPTDSFVGLITMDDQ +MYSSAR YEIGRR+PT Sbjct: 655 VDRCVLDFATEPTDSFVGLITMDDQGDMYSSARSYEIGRRRPT 697 >ref|XP_002280997.2| PREDICTED: DDB1- and CUL4-associated factor homolog 1-like [Vitis vinifera] Length = 2024 Score = 83.2 bits (204), Expect = 3e-14 Identities = 37/43 (86%), Positives = 42/43 (97%) Frame = -1 Query: 514 VDRCVLDFATEPTDSFVGLITMDDQDEMYSSARVYEIGRRKPT 386 VDRCVLDFATEPTDSFVGL++MDD DEM+SSAR+YEIGRR+PT Sbjct: 1869 VDRCVLDFATEPTDSFVGLVSMDDHDEMFSSARMYEIGRRRPT 1911 >emb|CBI20820.3| unnamed protein product [Vitis vinifera] Length = 1760 Score = 83.2 bits (204), Expect = 3e-14 Identities = 37/43 (86%), Positives = 42/43 (97%) Frame = -1 Query: 514 VDRCVLDFATEPTDSFVGLITMDDQDEMYSSARVYEIGRRKPT 386 VDRCVLDFATEPTDSFVGL++MDD DEM+SSAR+YEIGRR+PT Sbjct: 1605 VDRCVLDFATEPTDSFVGLVSMDDHDEMFSSARMYEIGRRRPT 1647 >ref|XP_002528006.1| conserved hypothetical protein [Ricinus communis] gi|223532632|gb|EEF34418.1| conserved hypothetical protein [Ricinus communis] Length = 1871 Score = 83.2 bits (204), Expect = 3e-14 Identities = 38/43 (88%), Positives = 42/43 (97%) Frame = -1 Query: 514 VDRCVLDFATEPTDSFVGLITMDDQDEMYSSARVYEIGRRKPT 386 VDRCVLDFA+E TDSFVGLITMDDQ+EMYSSAR+YEIGRR+PT Sbjct: 1713 VDRCVLDFASEATDSFVGLITMDDQEEMYSSARIYEIGRRRPT 1755 >ref|XP_004162499.1| PREDICTED: LOW QUALITY PROTEIN: DDB1- and CUL4-associated factor homolog 1-like [Cucumis sativus] Length = 1900 Score = 82.4 bits (202), Expect = 6e-14 Identities = 38/43 (88%), Positives = 41/43 (95%) Frame = -1 Query: 514 VDRCVLDFATEPTDSFVGLITMDDQDEMYSSARVYEIGRRKPT 386 +DRCVLDF TE TDSFVGLITMDDQDEM+SSARVYEIGRR+PT Sbjct: 1748 LDRCVLDFTTEKTDSFVGLITMDDQDEMFSSARVYEIGRRRPT 1790 >ref|XP_004136459.1| PREDICTED: DDB1- and CUL4-associated factor homolog 1-like [Cucumis sativus] Length = 1915 Score = 82.4 bits (202), Expect = 6e-14 Identities = 38/43 (88%), Positives = 41/43 (95%) Frame = -1 Query: 514 VDRCVLDFATEPTDSFVGLITMDDQDEMYSSARVYEIGRRKPT 386 +DRCVLDF TE TDSFVGLITMDDQDEM+SSARVYEIGRR+PT Sbjct: 1763 LDRCVLDFTTEKTDSFVGLITMDDQDEMFSSARVYEIGRRRPT 1805 >gb|EXB60457.1| DDB1- and CUL4-associated factor-1-like protein [Morus notabilis] Length = 1977 Score = 82.0 bits (201), Expect = 8e-14 Identities = 38/43 (88%), Positives = 41/43 (95%) Frame = -1 Query: 514 VDRCVLDFATEPTDSFVGLITMDDQDEMYSSARVYEIGRRKPT 386 VDRCVLDF TEPTDSFVGLITMDDQ+EMY+SARV EIGRR+PT Sbjct: 1824 VDRCVLDFTTEPTDSFVGLITMDDQEEMYASARVNEIGRRRPT 1866 >ref|XP_006382218.1| transducin family protein [Populus trichocarpa] gi|550337373|gb|ERP60015.1| transducin family protein [Populus trichocarpa] Length = 1887 Score = 82.0 bits (201), Expect = 8e-14 Identities = 38/43 (88%), Positives = 41/43 (95%) Frame = -1 Query: 514 VDRCVLDFATEPTDSFVGLITMDDQDEMYSSARVYEIGRRKPT 386 VDRCVLDFATE TDSF GLITMDDQ+EM+SSARVYEIGRR+PT Sbjct: 1732 VDRCVLDFATEATDSFAGLITMDDQEEMFSSARVYEIGRRRPT 1774