BLASTX nr result
ID: Mentha26_contig00015475
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha26_contig00015475 (330 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EYU34349.1| hypothetical protein MIMGU_mgv1a004242mg [Mimulus... 92 8e-17 >gb|EYU34349.1| hypothetical protein MIMGU_mgv1a004242mg [Mimulus guttatus] Length = 538 Score = 92.0 bits (227), Expect = 8e-17 Identities = 58/111 (52%), Positives = 70/111 (63%), Gaps = 2/111 (1%) Frame = +3 Query: 3 EEANNRSSDALQEKVSVDSEASEEGGAENRDEIA--EKFDEQRRVSSDSGSDCALGDSSK 176 EE NRSS AL +S G E RD+I EK DEQR V + A G++S Sbjct: 2 EEERNRSSVALPVTEIENSTPLNGGEGEIRDQIIIIEKIDEQRPVLN-----YAAGNNSG 56 Query: 177 GESKASKFQTLPSVELSSGDFRADFDDSSDQLSEVPVEYSLQPLPPGGELK 329 GESKA +F+TL SV+L GD +ADFD+SS LSEVPVEYSLQPL P E++ Sbjct: 57 GESKAPEFETLDSVQLPEGDLQADFDESSHLLSEVPVEYSLQPLKPTEEIE 107