BLASTX nr result
ID: Mentha26_contig00014263
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha26_contig00014263 (852 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_007029330.1| Tetratricopeptide repeat-like superfamily pr... 57 9e-06 >ref|XP_007029330.1| Tetratricopeptide repeat-like superfamily protein, putative [Theobroma cacao] gi|508717935|gb|EOY09832.1| Tetratricopeptide repeat-like superfamily protein, putative [Theobroma cacao] Length = 747 Score = 57.0 bits (136), Expect = 9e-06 Identities = 26/52 (50%), Positives = 33/52 (63%) Frame = -3 Query: 610 AVLPSTCSTKCFKGRFHVDVYTFTIAIHCFCHLNRVDFGFAILGTLFKRGYE 455 A++ S C G H D YT I I+CFCHL RVDFGF++LG + K GY+ Sbjct: 107 AIVVSLCKQMELLGIIH-DAYTLNILINCFCHLRRVDFGFSVLGKMLKLGYK 157