BLASTX nr result
ID: Mentha26_contig00004228
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha26_contig00004228 (349 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EYU31351.1| hypothetical protein MIMGU_mgv1a022905mg [Mimulus... 56 6e-06 ref|XP_002313287.1| hypothetical protein POPTR_0009s06890g [Popu... 55 1e-05 >gb|EYU31351.1| hypothetical protein MIMGU_mgv1a022905mg [Mimulus guttatus] Length = 262 Score = 55.8 bits (133), Expect = 6e-06 Identities = 26/35 (74%), Positives = 30/35 (85%) Frame = +3 Query: 243 RVSSNKEFLQVVLMSPQIPGNTGSIARTCAASAVK 347 + +NKEFLQVVL+SPQIPGNTG ARTCAA+ VK Sbjct: 72 KAPANKEFLQVVLVSPQIPGNTGCTARTCAATNVK 106 >ref|XP_002313287.1| hypothetical protein POPTR_0009s06890g [Populus trichocarpa] gi|222849695|gb|EEE87242.1| hypothetical protein POPTR_0009s06890g [Populus trichocarpa] Length = 264 Score = 55.1 bits (131), Expect = 1e-05 Identities = 26/33 (78%), Positives = 30/33 (90%) Frame = +3 Query: 246 VSSNKEFLQVVLMSPQIPGNTGSIARTCAASAV 344 VS NK+ LQVVL+SPQIPGNTG IARTCAA++V Sbjct: 75 VSRNKKLLQVVLVSPQIPGNTGCIARTCAATSV 107