BLASTX nr result
ID: Mentha25_contig00058770
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha25_contig00058770 (333 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value emb|CCU82989.1| hypothetical protein BGHDH14_bghG007361000001001... 64 2e-08 >emb|CCU82989.1| hypothetical protein BGHDH14_bghG007361000001001 [Blumeria graminis f. sp. hordei DH14] Length = 348 Score = 63.9 bits (154), Expect = 2e-08 Identities = 36/93 (38%), Positives = 53/93 (56%), Gaps = 1/93 (1%) Frame = +1 Query: 10 PPQLWNLPYIAYPPKMLEAASIIDEE*TSHLFASSAPQST-TISTQARNRLPLQPVTPFE 186 P + W+LPYI + P++L+AA I + E LFA+S + T + ST R P + ++ Sbjct: 110 PLKFWSLPYITHSPEILDAAIIFNPERVGELFAASGQKDTLSKSTPQVFREPALRIPLYD 169 Query: 187 GKPANLRSFCSQLVNQIQRNFSITELETVRFVF 285 G NL FCSQL+NQ+Q EL VR+ + Sbjct: 170 GTSGNLPLFCSQLMNQLQGQPFSDELSKVRYAY 202