BLASTX nr result
ID: Mentha25_contig00057894
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha25_contig00057894 (413 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_007161711.1| hypothetical protein PHAVU_001G091900g, part... 56 5e-06 >ref|XP_007161711.1| hypothetical protein PHAVU_001G091900g, partial [Phaseolus vulgaris] gi|561035175|gb|ESW33705.1| hypothetical protein PHAVU_001G091900g, partial [Phaseolus vulgaris] Length = 293 Score = 56.2 bits (134), Expect = 5e-06 Identities = 24/69 (34%), Positives = 41/69 (59%) Frame = -1 Query: 209 MPTFDGTEALAWIAQAEQYFLVSNIPLETRLQVAMDAVAAPAQPWLQLLTRRVPTLSWDR 30 +P FDG + +AWI +AE YF V N P + R++++ ++ P W LL LSW++ Sbjct: 131 LPLFDGEDPVAWITRAEIYFDVQNTPEDMRVKLSRLSMEGPTIHWFNLLMETEDQLSWEK 190 Query: 29 LTQEMLTRF 3 L + ++ R+ Sbjct: 191 LKRALIARY 199