BLASTX nr result
ID: Mentha25_contig00057732
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha25_contig00057732 (507 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|AFD53814.1| hypothetical protein, partial [Trichoderma harzia... 57 6e-10 >gb|AFD53814.1| hypothetical protein, partial [Trichoderma harzianum] Length = 108 Score = 56.6 bits (135), Expect(2) = 6e-10 Identities = 26/38 (68%), Positives = 29/38 (76%) Frame = -3 Query: 253 GGKTSHHGLNVVGDRRATYSYTK*CDNANWS*SSKVGY 140 G KTSHHGLN+VG RRATY++TK C N N S S K GY Sbjct: 39 GTKTSHHGLNIVGYRRATYAWTKRCKNVNLSLSQKTGY 76 Score = 32.7 bits (73), Expect(2) = 6e-10 Identities = 18/29 (62%), Positives = 18/29 (62%) Frame = -2 Query: 134 GL*SETRLYE*GITSNRE*ERHGGFNLIW 48 GL SE RLYE ITSNRE HG L W Sbjct: 80 GLWSEIRLYESVITSNRESPCHGELTLDW 108