BLASTX nr result
ID: Mentha25_contig00056930
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha25_contig00056930 (398 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EPQ67042.1| Component of the RSC chromatin remodeling complex... 58 1e-06 emb|CCU75603.1| nuclear localization protein NPL6 [Blumeria gram... 57 2e-06 >gb|EPQ67042.1| Component of the RSC chromatin remodeling complex [Blumeria graminis f. sp. tritici 96224] Length = 517 Score = 58.2 bits (139), Expect = 1e-06 Identities = 23/35 (65%), Positives = 30/35 (85%) Frame = -2 Query: 391 SLEDTLKMEKQWKSKWGPESEHGYRRPPIINKGVV 287 + ++ L ME+QWKS+WG ESEH +RRPPII+KGVV Sbjct: 483 AFDEALNMEQQWKSRWGSESEHSHRRPPIIDKGVV 517 >emb|CCU75603.1| nuclear localization protein NPL6 [Blumeria graminis f. sp. hordei DH14] Length = 517 Score = 57.4 bits (137), Expect = 2e-06 Identities = 23/35 (65%), Positives = 29/35 (82%) Frame = -2 Query: 391 SLEDTLKMEKQWKSKWGPESEHGYRRPPIINKGVV 287 + + L ME+QWKS+WG ESEH +RRPPII+KGVV Sbjct: 483 AFDQALNMEQQWKSRWGSESEHSHRRPPIIDKGVV 517