BLASTX nr result
ID: Mentha25_contig00056740
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha25_contig00056740 (487 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value emb|CCU81205.1| RING finger membrane protein [Blumeria graminis ... 110 2e-22 gb|EPQ66787.1| Ubiquitin-protein ligase of the ER-nuclear envelo... 107 2e-21 ref|XP_007288231.1| RING finger membrane protein [Marssonina bru... 103 2e-20 gb|EPE32664.1| RING/U-box [Glarea lozoyensis ATCC 20868] 89 5e-16 gb|EHK96934.1| putative ERAD-associated E3 ubiquitin-protein lig... 89 5e-16 ref|XP_002146559.1| RING finger membrane protein [Talaromyces ma... 68 2e-09 ref|XP_003018846.1| RING finger membrane protein [Trichophyton v... 66 6e-09 gb|EHA25186.1| hypothetical protein ASPNIDRAFT_211628 [Aspergill... 65 1e-08 ref|XP_001395474.2| RING finger membrane protein [Aspergillus ni... 65 1e-08 ref|XP_002478858.1| RING finger membrane protein [Talaromyces st... 65 1e-08 emb|CAK46170.1| unnamed protein product [Aspergillus niger] 65 1e-08 dbj|BAE65280.1| unnamed protein product [Aspergillus oryzae RIB40] 65 1e-08 gb|EIT78688.1| protein involved in mRNA turnover and stability [... 65 1e-08 dbj|GAA86432.1| RING finger membrane protein [Aspergillus kawach... 65 1e-08 ref|XP_001826413.2| RING finger membrane protein [Aspergillus or... 65 1e-08 ref|XP_002378100.1| RING finger membrane protein [Aspergillus fl... 65 1e-08 ref|XP_001218322.1| conserved hypothetical protein [Aspergillus ... 64 2e-08 gb|EZF36411.1| hypothetical protein H101_00099 [Trichophyton int... 64 2e-08 gb|EGE02923.1| RING finger membrane protein [Trichophyton equinu... 64 2e-08 gb|EGD93570.1| hypothetical protein TESG_01112 [Trichophyton ton... 64 2e-08 >emb|CCU81205.1| RING finger membrane protein [Blumeria graminis f. sp. hordei DH14] Length = 1764 Score = 110 bits (276), Expect = 2e-22 Identities = 46/81 (56%), Positives = 61/81 (75%) Frame = +3 Query: 12 ALFYPLALAKIMVITTLKRFPEKHILAYRYSYPICLYLCFLAFFLWVLSGWVHNWKIKIR 191 A F P ALA++++ T L+ P+KH L YRYSYP+ L LC +A LW++ GW NWK+KIR Sbjct: 1673 AFFIPWALARLLISTMLRNSPDKHTLTYRYSYPVFLCLCCMALILWIMMGWARNWKLKIR 1732 Query: 192 DEVYSDGERLHNFGERRVQQI 254 D+VY GERLHNFG+R+VQ + Sbjct: 1733 DDVYLIGERLHNFGDRKVQNM 1753 >gb|EPQ66787.1| Ubiquitin-protein ligase of the ER-nuclear envelope [Blumeria graminis f. sp. tritici 96224] Length = 1764 Score = 107 bits (267), Expect = 2e-21 Identities = 45/81 (55%), Positives = 60/81 (74%) Frame = +3 Query: 12 ALFYPLALAKIMVITTLKRFPEKHILAYRYSYPICLYLCFLAFFLWVLSGWVHNWKIKIR 191 A P ALA++++ T L+ P+KH L YRYSYP+ L LC +A LW++ GW NWK+KIR Sbjct: 1673 AFSIPWALARLIISTMLRNSPDKHTLTYRYSYPVFLCLCGMALILWIMMGWARNWKLKIR 1732 Query: 192 DEVYSDGERLHNFGERRVQQI 254 D+VY GERLHNFG+R+VQ + Sbjct: 1733 DDVYLIGERLHNFGDRKVQNL 1753 >ref|XP_007288231.1| RING finger membrane protein [Marssonina brunnea f. sp. 'multigermtubi' MB_m1] gi|406868192|gb|EKD21229.1| RING finger membrane protein [Marssonina brunnea f. sp. 'multigermtubi' MB_m1] Length = 1813 Score = 103 bits (258), Expect = 2e-20 Identities = 50/92 (54%), Positives = 64/92 (69%), Gaps = 1/92 (1%) Frame = +3 Query: 12 ALFYPLALAKIMVITTLKRFPEKHILAYRYSYPICLYLCFLAFFLWVLSGWVHNWKIKIR 191 AL+YP LA++ T LK PE H LAYRY+YP+CL +C + + WVL GWV +W++KIR Sbjct: 1722 ALWYPWLLARLATNTVLKDNPELHTLAYRYAYPMCLCMCAIGYAWWVLFGWVKDWRMKIR 1781 Query: 192 DEVYSDGERLHNFGERR-VQQIQTNNVRRNET 284 DEVY GERLHNFG+R+ + VRR ET Sbjct: 1782 DEVYLIGERLHNFGDRKGAVGMGVPGVRRIET 1813 >gb|EPE32664.1| RING/U-box [Glarea lozoyensis ATCC 20868] Length = 1776 Score = 89.4 bits (220), Expect = 5e-16 Identities = 39/78 (50%), Positives = 54/78 (69%) Frame = +3 Query: 12 ALFYPLALAKIMVITTLKRFPEKHILAYRYSYPICLYLCFLAFFLWVLSGWVHNWKIKIR 191 AL P +A+++V T K P+ H++AYRY+YPICL + LW + G + +W++ IR Sbjct: 1680 ALMIPHGIARVIVATVFKNSPQIHLIAYRYAYPICLASWIMTLALWRIFGMLKDWRMMIR 1739 Query: 192 DEVYSDGERLHNFGERRV 245 DEVY GERLHNFGER+V Sbjct: 1740 DEVYLIGERLHNFGERKV 1757 >gb|EHK96934.1| putative ERAD-associated E3 ubiquitin-protein ligase doa10 [Glarea lozoyensis 74030] Length = 1185 Score = 89.4 bits (220), Expect = 5e-16 Identities = 39/78 (50%), Positives = 54/78 (69%) Frame = +3 Query: 12 ALFYPLALAKIMVITTLKRFPEKHILAYRYSYPICLYLCFLAFFLWVLSGWVHNWKIKIR 191 AL P +A+++V T K P+ H++AYRY+YPICL + LW + G + +W++ IR Sbjct: 1089 ALMIPHGIARVIVATVFKNSPQIHLIAYRYAYPICLASWIMTLALWRIFGMLKDWRMMIR 1148 Query: 192 DEVYSDGERLHNFGERRV 245 DEVY GERLHNFGER+V Sbjct: 1149 DEVYLIGERLHNFGERKV 1166 >ref|XP_002146559.1| RING finger membrane protein [Talaromyces marneffei ATCC 18224] gi|210071923|gb|EEA26012.1| RING finger membrane protein [Talaromyces marneffei ATCC 18224] Length = 1592 Score = 67.8 bits (164), Expect = 2e-09 Identities = 38/93 (40%), Positives = 52/93 (55%), Gaps = 4/93 (4%) Frame = +3 Query: 6 FIALFYPLALAKIMVITTLKRFPEKHILA----YRYSYPICLYLCFLAFFLWVLSGWVHN 173 F+A+ PL I T FPE ++ YRYSYP L C + + L++L V+ Sbjct: 1499 FLAVSLPLGFGAIAKATM---FPEPTTVSQSTVYRYSYPATLAACLVMYALYLLRRQVNV 1555 Query: 174 WKIKIRDEVYSDGERLHNFGERRVQQIQTNNVR 272 W+ IRDE+Y GERLHNFGE+R + + N R Sbjct: 1556 WRANIRDEMYLIGERLHNFGEKRARDVTGVNRR 1588 >ref|XP_003018846.1| RING finger membrane protein [Trichophyton verrucosum HKI 0517] gi|291182527|gb|EFE38201.1| RING finger membrane protein [Trichophyton verrucosum HKI 0517] Length = 1626 Score = 65.9 bits (159), Expect = 6e-09 Identities = 37/88 (42%), Positives = 49/88 (55%), Gaps = 4/88 (4%) Frame = +3 Query: 3 VFIALFYPLALAKIMVITTLKRFPEK----HILAYRYSYPICLYLCFLAFFLWVLSGWVH 170 VF+A PL + I+ T FPE H YRYSYP L L L + L +L + Sbjct: 1533 VFVATVCPLPIGYILNSTL---FPESSSTFHSQVYRYSYPAFLVLILLLWGLHLLQRQIG 1589 Query: 171 NWKIKIRDEVYSDGERLHNFGERRVQQI 254 W++ IRD+VY GERLHN GE+R + + Sbjct: 1590 VWRVSIRDDVYMIGERLHNLGEKRARNV 1617 >gb|EHA25186.1| hypothetical protein ASPNIDRAFT_211628 [Aspergillus niger ATCC 1015] Length = 1612 Score = 65.1 bits (157), Expect = 1e-08 Identities = 30/82 (36%), Positives = 46/82 (56%) Frame = +3 Query: 9 IALFYPLALAKIMVITTLKRFPEKHILAYRYSYPICLYLCFLAFFLWVLSGWVHNWKIKI 188 +A+ PL L M T PE YRY+YP L + + + ++++ V W++ I Sbjct: 1522 LAVVVPLILGFCMNATVFSSTPEVQSKVYRYAYPATLVISLIGWLVYLVRRQVEIWRVNI 1581 Query: 189 RDEVYSDGERLHNFGERRVQQI 254 RD+VY GERLHNF E+R + + Sbjct: 1582 RDDVYLIGERLHNFREKRARDV 1603 >ref|XP_001395474.2| RING finger membrane protein [Aspergillus niger CBS 513.88] Length = 1598 Score = 65.1 bits (157), Expect = 1e-08 Identities = 30/82 (36%), Positives = 46/82 (56%) Frame = +3 Query: 9 IALFYPLALAKIMVITTLKRFPEKHILAYRYSYPICLYLCFLAFFLWVLSGWVHNWKIKI 188 +A+ PL L M T PE YRY+YP L + + + ++++ V W++ I Sbjct: 1508 LAVVVPLILGFCMNATVFSSTPEVQSKVYRYAYPATLVISLIGWLVYLVRRQVEIWRVNI 1567 Query: 189 RDEVYSDGERLHNFGERRVQQI 254 RD+VY GERLHNF E+R + + Sbjct: 1568 RDDVYLIGERLHNFREKRARDV 1589 >ref|XP_002478858.1| RING finger membrane protein [Talaromyces stipitatus ATCC 10500] gi|218722477|gb|EED21895.1| RING finger membrane protein [Talaromyces stipitatus ATCC 10500] Length = 1604 Score = 65.1 bits (157), Expect = 1e-08 Identities = 35/87 (40%), Positives = 47/87 (54%), Gaps = 4/87 (4%) Frame = +3 Query: 6 FIALFYPLALAKIMVITTLKRFPEKHILA----YRYSYPICLYLCFLAFFLWVLSGWVHN 173 F+A+ PL I T FP+ + YRYSYP L C + L++L + Sbjct: 1511 FLAVSLPLGFGLIAKATA---FPDNATVTQSTVYRYSYPATLVACLSIYALYLLRRQIDV 1567 Query: 174 WKIKIRDEVYSDGERLHNFGERRVQQI 254 W+ IRDEVY GERLHNFGE+R + + Sbjct: 1568 WRANIRDEVYLIGERLHNFGEKRARDV 1594 >emb|CAK46170.1| unnamed protein product [Aspergillus niger] Length = 1510 Score = 65.1 bits (157), Expect = 1e-08 Identities = 30/82 (36%), Positives = 46/82 (56%) Frame = +3 Query: 9 IALFYPLALAKIMVITTLKRFPEKHILAYRYSYPICLYLCFLAFFLWVLSGWVHNWKIKI 188 +A+ PL L M T PE YRY+YP L + + + ++++ V W++ I Sbjct: 1420 LAVVVPLILGFCMNATVFSSTPEVQSKVYRYAYPATLVISLIGWLVYLVRRQVEIWRVNI 1479 Query: 189 RDEVYSDGERLHNFGERRVQQI 254 RD+VY GERLHNF E+R + + Sbjct: 1480 RDDVYLIGERLHNFREKRARDV 1501 >dbj|BAE65280.1| unnamed protein product [Aspergillus oryzae RIB40] Length = 1628 Score = 64.7 bits (156), Expect = 1e-08 Identities = 31/82 (37%), Positives = 48/82 (58%) Frame = +3 Query: 9 IALFYPLALAKIMVITTLKRFPEKHILAYRYSYPICLYLCFLAFFLWVLSGWVHNWKIKI 188 +A+ PLA ++ T PE YRY+YP+ L L L + ++++ V W++ I Sbjct: 1538 VAVALPLAGGFLVNSTVFYSTPEVQFKVYRYAYPLTLLLSLLFWIGFLVNRQVEKWRVNI 1597 Query: 189 RDEVYSDGERLHNFGERRVQQI 254 RD+VY GERLHNF E+R + + Sbjct: 1598 RDDVYLIGERLHNFREKRAKDV 1619 >gb|EIT78688.1| protein involved in mRNA turnover and stability [Aspergillus oryzae 3.042] Length = 1628 Score = 64.7 bits (156), Expect = 1e-08 Identities = 31/82 (37%), Positives = 48/82 (58%) Frame = +3 Query: 9 IALFYPLALAKIMVITTLKRFPEKHILAYRYSYPICLYLCFLAFFLWVLSGWVHNWKIKI 188 +A+ PLA ++ T PE YRY+YP+ L L L + ++++ V W++ I Sbjct: 1538 VAVALPLAGGFLVNSTVFYSTPEVQFKVYRYAYPLTLLLSLLFWIGFLVNRQVEKWRVNI 1597 Query: 189 RDEVYSDGERLHNFGERRVQQI 254 RD+VY GERLHNF E+R + + Sbjct: 1598 RDDVYLIGERLHNFREKRAKDV 1619 >dbj|GAA86432.1| RING finger membrane protein [Aspergillus kawachii IFO 4308] Length = 1612 Score = 64.7 bits (156), Expect = 1e-08 Identities = 30/82 (36%), Positives = 46/82 (56%) Frame = +3 Query: 9 IALFYPLALAKIMVITTLKRFPEKHILAYRYSYPICLYLCFLAFFLWVLSGWVHNWKIKI 188 +A+ PL L M T PE YRY+YP L + + + ++++ V W++ I Sbjct: 1522 LAVVVPLILGFSMNATVFSSTPEVQSKVYRYAYPATLVISLMGWLVYLVRRQVEIWRVNI 1581 Query: 189 RDEVYSDGERLHNFGERRVQQI 254 RD+VY GERLHNF E+R + + Sbjct: 1582 RDDVYLIGERLHNFREKRARDV 1603 >ref|XP_001826413.2| RING finger membrane protein [Aspergillus oryzae RIB40] Length = 1606 Score = 64.7 bits (156), Expect = 1e-08 Identities = 31/82 (37%), Positives = 48/82 (58%) Frame = +3 Query: 9 IALFYPLALAKIMVITTLKRFPEKHILAYRYSYPICLYLCFLAFFLWVLSGWVHNWKIKI 188 +A+ PLA ++ T PE YRY+YP+ L L L + ++++ V W++ I Sbjct: 1516 VAVALPLAGGFLVNSTVFYSTPEVQFKVYRYAYPLTLLLSLLFWIGFLVNRQVEKWRVNI 1575 Query: 189 RDEVYSDGERLHNFGERRVQQI 254 RD+VY GERLHNF E+R + + Sbjct: 1576 RDDVYLIGERLHNFREKRAKDV 1597 >ref|XP_002378100.1| RING finger membrane protein [Aspergillus flavus NRRL3357] gi|220696594|gb|EED52936.1| RING finger membrane protein [Aspergillus flavus NRRL3357] Length = 1144 Score = 64.7 bits (156), Expect = 1e-08 Identities = 31/82 (37%), Positives = 48/82 (58%) Frame = +3 Query: 9 IALFYPLALAKIMVITTLKRFPEKHILAYRYSYPICLYLCFLAFFLWVLSGWVHNWKIKI 188 +A+ PLA ++ T PE YRY+YP+ L L L + ++++ V W++ I Sbjct: 1054 VAVALPLAGGFLVNSTVFYSTPEVQFKVYRYAYPLTLLLSLLFWIGFLVNRQVEKWRVNI 1113 Query: 189 RDEVYSDGERLHNFGERRVQQI 254 RD+VY GERLHNF E+R + + Sbjct: 1114 RDDVYLIGERLHNFREKRAKDV 1135 >ref|XP_001218322.1| conserved hypothetical protein [Aspergillus terreus NIH2624] gi|114188191|gb|EAU29891.1| conserved hypothetical protein [Aspergillus terreus NIH2624] Length = 1604 Score = 64.3 bits (155), Expect = 2e-08 Identities = 30/82 (36%), Positives = 48/82 (58%) Frame = +3 Query: 9 IALFYPLALAKIMVITTLKRFPEKHILAYRYSYPICLYLCFLAFFLWVLSGWVHNWKIKI 188 +A+ PL+L ++ T + H + YRYSYP+ L L + +++ + W+I I Sbjct: 1514 LAVALPLSLGFVLNSTMFYSAVDMHSMVYRYSYPVTLLFTLLGWLGYLVYRQLEIWRISI 1573 Query: 189 RDEVYSDGERLHNFGERRVQQI 254 RD+VY GERLHNF E+R + + Sbjct: 1574 RDDVYLIGERLHNFREKRTRDV 1595 >gb|EZF36411.1| hypothetical protein H101_00099 [Trichophyton interdigitale H6] Length = 1627 Score = 63.9 bits (154), Expect = 2e-08 Identities = 34/85 (40%), Positives = 46/85 (54%), Gaps = 1/85 (1%) Frame = +3 Query: 3 VFIALFYPLALAKIMVITTLKRFPEK-HILAYRYSYPICLYLCFLAFFLWVLSGWVHNWK 179 VF+A PL + I+ T H YRYSYP L L L + L +L + W+ Sbjct: 1534 VFVATVCPLPIGYILNSTLFSESSSTIHSQVYRYSYPAFLVLILLLWGLHLLQRQIGVWR 1593 Query: 180 IKIRDEVYSDGERLHNFGERRVQQI 254 + IRD+VY GERLHN GE+R + + Sbjct: 1594 VSIRDDVYMIGERLHNLGEKRARNV 1618 >gb|EGE02923.1| RING finger membrane protein [Trichophyton equinum CBS 127.97] Length = 1626 Score = 63.9 bits (154), Expect = 2e-08 Identities = 34/85 (40%), Positives = 46/85 (54%), Gaps = 1/85 (1%) Frame = +3 Query: 3 VFIALFYPLALAKIMVITTLKRFPEK-HILAYRYSYPICLYLCFLAFFLWVLSGWVHNWK 179 VF+A PL + I+ T H YRYSYP L L L + L +L + W+ Sbjct: 1533 VFVATVCPLPIGYILNSTLFSESSSTIHSQVYRYSYPAFLVLILLLWGLHLLQRQIGVWR 1592 Query: 180 IKIRDEVYSDGERLHNFGERRVQQI 254 + IRD+VY GERLHN GE+R + + Sbjct: 1593 VSIRDDVYMIGERLHNLGEKRARNV 1617 >gb|EGD93570.1| hypothetical protein TESG_01112 [Trichophyton tonsurans CBS 112818] Length = 1626 Score = 63.9 bits (154), Expect = 2e-08 Identities = 34/85 (40%), Positives = 46/85 (54%), Gaps = 1/85 (1%) Frame = +3 Query: 3 VFIALFYPLALAKIMVITTLKRFPEK-HILAYRYSYPICLYLCFLAFFLWVLSGWVHNWK 179 VF+A PL + I+ T H YRYSYP L L L + L +L + W+ Sbjct: 1533 VFVATVCPLPIGYILNSTLFSESSSTIHSQVYRYSYPAFLVLILLLWGLHLLQRQIGVWR 1592 Query: 180 IKIRDEVYSDGERLHNFGERRVQQI 254 + IRD+VY GERLHN GE+R + + Sbjct: 1593 VSIRDDVYMIGERLHNLGEKRARNV 1617