BLASTX nr result
ID: Mentha25_contig00056615
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha25_contig00056615 (430 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value emb|CCU76341.1| putative Bgh-specific protein [Blumeria graminis... 66 4e-09 gb|EPQ63829.1| hypothetical protein BGT96224_5293 [Blumeria gram... 66 6e-09 >emb|CCU76341.1| putative Bgh-specific protein [Blumeria graminis f. sp. hordei DH14] Length = 676 Score = 66.2 bits (160), Expect = 4e-09 Identities = 33/60 (55%), Positives = 40/60 (66%), Gaps = 1/60 (1%) Frame = +2 Query: 2 SLVEQIRSSSLGETDTWFTKKVNCGLEQPKPLRAVEMKRMMLLCRGRFGSG-NMTRNSLP 178 S+ E+ S L E++ W ++V C L+QPKPLR VEMKRMM LCRG G G RNSLP Sbjct: 616 SMSEKNSLSGLEESENWLIRRVECALKQPKPLRVVEMKRMMHLCRGLIGGGMRRMRNSLP 675 >gb|EPQ63829.1| hypothetical protein BGT96224_5293 [Blumeria graminis f. sp. tritici 96224] Length = 676 Score = 65.9 bits (159), Expect = 6e-09 Identities = 32/60 (53%), Positives = 40/60 (66%), Gaps = 1/60 (1%) Frame = +2 Query: 2 SLVEQIRSSSLGETDTWFTKKVNCGLEQPKPLRAVEMKRMMLLCRGRFGSG-NMTRNSLP 178 S+ E+ S + E++ W ++V C L+QPKPLR VEMKRMM LCRG G G RNSLP Sbjct: 616 SMSEKDSLSGIEESENWLIRRVECALKQPKPLRVVEMKRMMHLCRGMIGGGMRRMRNSLP 675