BLASTX nr result
ID: Mentha25_contig00056585
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha25_contig00056585 (421 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_007294759.1| hypothetical protein MBM_06870 [Marssonina b... 56 6e-06 >ref|XP_007294759.1| hypothetical protein MBM_06870 [Marssonina brunnea f. sp. 'multigermtubi' MB_m1] gi|406862057|gb|EKD15109.1| hypothetical protein MBM_06870 [Marssonina brunnea f. sp. 'multigermtubi' MB_m1] Length = 578 Score = 55.8 bits (133), Expect = 6e-06 Identities = 23/42 (54%), Positives = 32/42 (76%) Frame = -2 Query: 126 MESLEYTLENKEQFWSEVDDILSMKCRSPQSIYNVFRTYLNF 1 ME EY+LEN++QFW E++DI+S KC S Q I N R++L+F Sbjct: 93 MEEFEYSLENEQQFWDEIEDIVSAKCESHQLIDNALRSFLHF 134