BLASTX nr result
ID: Mentha25_contig00055900
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha25_contig00055900 (578 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_007015750.1| F-box and associated interaction domains-con... 74 3e-11 >ref|XP_007015750.1| F-box and associated interaction domains-containing protein, putative isoform 1 [Theobroma cacao] gi|590586605|ref|XP_007015751.1| F-box and associated interaction domains-containing protein, putative isoform 1 [Theobroma cacao] gi|508786113|gb|EOY33369.1| F-box and associated interaction domains-containing protein, putative isoform 1 [Theobroma cacao] gi|508786114|gb|EOY33370.1| F-box and associated interaction domains-containing protein, putative isoform 1 [Theobroma cacao] Length = 387 Score = 73.9 bits (180), Expect = 3e-11 Identities = 48/140 (34%), Positives = 72/140 (51%) Frame = +2 Query: 47 ILCFDFCGEKFSTVPFPPSPKEMAKTHMCRLLDYGGRLGIVVHPNEGRRNENVSSFEVXX 226 IL FD EKFST+P P +A+ ++ +LLD+ G LG +V+P EG S ++ Sbjct: 239 ILSFDMANEKFSTLPLPTFGGSLAQYYL-QLLDFNGSLGAIVYPREGTEK----SIDLWV 293 Query: 227 XXXXXXXXXXXXKELDCCIEGVVNPLGFSEDGGMLFLEGRDRVLHVFDFGTKKLTKLNVY 406 + GV PLGF ++G LFLE + L +FD T++L L ++ Sbjct: 294 MNGSWTRQFSIES-----VSGVERPLGFWKNGE-LFLESSNHELVLFDPATRELKNLGIH 347 Query: 407 CNRHLFDLISYRESRFPLNG 466 ++ LI+Y ES P+NG Sbjct: 348 AYQNTMQLIAYVESLVPING 367