BLASTX nr result
ID: Mentha25_contig00055814
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha25_contig00055814 (510 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value emb|CCU77387.1| putative Hydroxyacyl-thioester dehydratase type ... 89 6e-16 >emb|CCU77387.1| putative Hydroxyacyl-thioester dehydratase type 2 [Blumeria graminis f. sp. hordei DH14] Length = 478 Score = 89.0 bits (219), Expect = 6e-16 Identities = 46/76 (60%), Positives = 56/76 (73%), Gaps = 1/76 (1%) Frame = -1 Query: 234 TNSLEMLEKSLREKLLARPEITVYDHMAPTPSQLLKTSLQSDLPFIKSCLDIKQRNK-GK 58 +N+ E L+KSLRE+LLARP IT +DHM+PTPS LL+T L S LPFI D + R+K K Sbjct: 158 SNTFEKLQKSLREQLLARPAITYFDHMSPTPSNLLRTLLSSYLPFIGKYQDDEIRSKDNK 217 Query: 57 FYLPAGHHFVYFNPPV 10 F LP GHHFVYF+ V Sbjct: 218 FCLPLGHHFVYFHSDV 233