BLASTX nr result
ID: Mentha25_contig00055639
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha25_contig00055639 (401 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EPE37045.1| hypothetical protein GLAREA_09208 [Glarea lozoyen... 82 8e-14 ref|XP_007290027.1| hypothetical protein MBM_02138 [Marssonina b... 74 2e-11 emb|CCU75645.1| hypothetical protein BGHDH14_bghG001544000001001... 69 5e-10 gb|EPQ63717.1| hypothetical protein BGT96224_A20023 [Blumeria gr... 67 3e-09 emb|CCD54077.1| hypothetical protein BofuT4_uP127770.1 [Botryoti... 62 1e-07 ref|XP_001556926.1| hypothetical protein BC1G_04642 [Botryotinia... 62 1e-07 gb|ESZ97656.1| hypothetical protein SBOR_1972 [Sclerotinia borea... 61 1e-07 ref|XP_003838322.1| predicted protein [Leptosphaeria maculans JN... 60 2e-07 gb|EOA81442.1| hypothetical protein SETTUDRAFT_181655 [Setosphae... 60 4e-07 ref|XP_001937784.1| predicted protein [Pyrenophora tritici-repen... 60 4e-07 ref|XP_001790949.1| hypothetical protein SNOG_00258 [Phaeosphaer... 58 2e-06 gb|EKG13982.1| hypothetical protein MPH_08856 [Macrophomina phas... 57 3e-06 >gb|EPE37045.1| hypothetical protein GLAREA_09208 [Glarea lozoyensis ATCC 20868] Length = 521 Score = 82.0 bits (201), Expect = 8e-14 Identities = 33/56 (58%), Positives = 39/56 (69%) Frame = -2 Query: 400 RKGRNKLCPVGCMICQKKDREMRWTCTWCYLSACADCTLLLNKTPGKDLRACLKKV 233 R RN CPV CMIC+++D E RW C+WC LSAC C LL K PGKD+R L+KV Sbjct: 459 RNARNSFCPVACMICRRQDSEQRWRCSWCCLSACGSCMSLLAKVPGKDVRVVLEKV 514 >ref|XP_007290027.1| hypothetical protein MBM_02138 [Marssonina brunnea f. sp. 'multigermtubi' MB_m1] gi|406867147|gb|EKD20186.1| hypothetical protein MBM_02138 [Marssonina brunnea f. sp. 'multigermtubi' MB_m1] Length = 519 Score = 74.3 bits (181), Expect = 2e-11 Identities = 29/57 (50%), Positives = 38/57 (66%) Frame = -2 Query: 400 RKGRNKLCPVGCMICQKKDREMRWTCTWCYLSACADCTLLLNKTPGKDLRACLKKVQ 230 R+ N CPV CMICQ KD RW C WC L AC C +L++ PG+DLR CL++++ Sbjct: 458 RRTTNGKCPVACMICQGKDTRDRWRCMWCNLGACGSCMQVLSQIPGRDLRVCLEQLE 514 >emb|CCU75645.1| hypothetical protein BGHDH14_bghG001544000001001 [Blumeria graminis f. sp. hordei DH14] Length = 350 Score = 69.3 bits (168), Expect = 5e-10 Identities = 30/53 (56%), Positives = 34/53 (64%) Frame = -2 Query: 400 RKGRNKLCPVGCMICQKKDREMRWTCTWCYLSACADCTLLLNKTPGKDLRACL 242 R NK PV CM+CQK D E RW CTWC LSAC C L+ TP ++LR CL Sbjct: 289 RNSPNKRYPVACMVCQKMDTEPRWRCTWCCLSACRVCLGELHATPHRNLRTCL 341 >gb|EPQ63717.1| hypothetical protein BGT96224_A20023 [Blumeria graminis f. sp. tritici 96224] Length = 399 Score = 66.6 bits (161), Expect = 3e-09 Identities = 29/53 (54%), Positives = 32/53 (60%) Frame = -2 Query: 400 RKGRNKLCPVGCMICQKKDREMRWTCTWCYLSACADCTLLLNKTPGKDLRACL 242 R NK PV CM+CQK D E RW CTWC LS C C L+ TP +LR CL Sbjct: 338 RNSPNKRYPVACMVCQKMDTEPRWRCTWCCLSTCRVCLGELHATPHHNLRTCL 390 >emb|CCD54077.1| hypothetical protein BofuT4_uP127770.1 [Botryotinia fuckeliana T4] Length = 95 Score = 61.6 bits (148), Expect = 1e-07 Identities = 27/56 (48%), Positives = 33/56 (58%) Frame = -2 Query: 400 RKGRNKLCPVGCMICQKKDREMRWTCTWCYLSACADCTLLLNKTPGKDLRACLKKV 233 R+ RN LCP+ C C K D E +W CTWC L C+DC +L T KDL LK + Sbjct: 2 RRSRNNLCPLQCQTCSKGDFEQQWKCTWCCLRVCSDCMAVL-ATVQKDLGTFLKLI 56 >ref|XP_001556926.1| hypothetical protein BC1G_04642 [Botryotinia fuckeliana B05.10] gi|472243498|gb|EMR88153.1| hypothetical protein BcDW1_3265 [Botryotinia fuckeliana BcDW1] Length = 561 Score = 61.6 bits (148), Expect = 1e-07 Identities = 27/56 (48%), Positives = 33/56 (58%) Frame = -2 Query: 400 RKGRNKLCPVGCMICQKKDREMRWTCTWCYLSACADCTLLLNKTPGKDLRACLKKV 233 R+ RN LCP+ C C K D E +W CTWC L C+DC +L T KDL LK + Sbjct: 468 RRSRNNLCPLQCQTCSKGDFEQQWKCTWCCLRVCSDCMAVL-ATVQKDLGTFLKLI 522 >gb|ESZ97656.1| hypothetical protein SBOR_1972 [Sclerotinia borealis F-4157] Length = 524 Score = 61.2 bits (147), Expect = 1e-07 Identities = 26/53 (49%), Positives = 31/53 (58%) Frame = -2 Query: 400 RKGRNKLCPVGCMICQKKDREMRWTCTWCYLSACADCTLLLNKTPGKDLRACL 242 R+ RN +CP+ C C K D E +W CTWC L C DC +L T KDLR L Sbjct: 431 RRSRNNICPLQCQTCSKSDFEQQWKCTWCCLRVCGDCMAIL-ITVRKDLRTFL 482 >ref|XP_003838322.1| predicted protein [Leptosphaeria maculans JN3] gi|312214889|emb|CBX94843.1| predicted protein [Leptosphaeria maculans JN3] Length = 679 Score = 60.5 bits (145), Expect = 2e-07 Identities = 24/57 (42%), Positives = 35/57 (61%) Frame = -2 Query: 388 NKLCPVGCMICQKKDREMRWTCTWCYLSACADCTLLLNKTPGKDLRACLKKVQALQD 218 N L +GCM+C K D E +WTC+WC L C C+ L PG+DLR +++ + + D Sbjct: 578 NALQSLGCMLCHKNDPERKWTCSWCNLRICWACSEELKSVPGRDLRVLVERRKEVGD 634 >gb|EOA81442.1| hypothetical protein SETTUDRAFT_181655 [Setosphaeria turcica Et28A] Length = 659 Score = 59.7 bits (143), Expect = 4e-07 Identities = 21/57 (36%), Positives = 36/57 (63%) Frame = -2 Query: 388 NKLCPVGCMICQKKDREMRWTCTWCYLSACADCTLLLNKTPGKDLRACLKKVQALQD 218 N P+GCM+C + +E +W+CTWC L C C+ L + PG+D+ ++ +AL++ Sbjct: 565 NLFQPLGCMVCHENTKERKWSCTWCQLRICRPCSDELRRVPGRDVAVLVQARRALEE 621 >ref|XP_001937784.1| predicted protein [Pyrenophora tritici-repentis Pt-1C-BFP] gi|187984883|gb|EDU50371.1| predicted protein [Pyrenophora tritici-repentis Pt-1C-BFP] Length = 656 Score = 59.7 bits (143), Expect = 4e-07 Identities = 21/45 (46%), Positives = 30/45 (66%) Frame = -2 Query: 388 NKLCPVGCMICQKKDREMRWTCTWCYLSACADCTLLLNKTPGKDL 254 N P+ CM+C++ +RE +WTCTWC L C +C+ L PG+DL Sbjct: 591 NTFQPMACMVCRENNRERKWTCTWCQLRICGNCSEELKAVPGRDL 635 >ref|XP_001790949.1| hypothetical protein SNOG_00258 [Phaeosphaeria nodorum SN15] gi|160701000|gb|EAT91753.2| hypothetical protein SNOG_00258 [Phaeosphaeria nodorum SN15] Length = 409 Score = 57.8 bits (138), Expect = 2e-06 Identities = 23/55 (41%), Positives = 33/55 (60%) Frame = -2 Query: 388 NKLCPVGCMICQKKDREMRWTCTWCYLSACADCTLLLNKTPGKDLRACLKKVQAL 224 N P+GCMIC +RE +W CTWC L C +C+ L PG++L L++ + L Sbjct: 330 NTFQPMGCMICHLNNRERKWCCTWCQLRICMNCSQELCMVPGRNLEVYLQEREKL 384 >gb|EKG13982.1| hypothetical protein MPH_08856 [Macrophomina phaseolina MS6] Length = 601 Score = 56.6 bits (135), Expect = 3e-06 Identities = 21/54 (38%), Positives = 28/54 (51%) Frame = -2 Query: 397 KGRNKLCPVGCMICQKKDREMRWTCTWCYLSACADCTLLLNKTPGKDLRACLKK 236 + N++ PVGCM+C + WTCTWC L C C L P K L +K+ Sbjct: 504 RSNNRVLPVGCMLCFSASTDFHWTCTWCALRICQGCRARLESIPRKSLEVLIKE 557