BLASTX nr result
ID: Mentha25_contig00054868
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha25_contig00054868 (403 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_755444.1| nuclear condensin complex subunit Smc2 [Aspergi... 65 1e-08 dbj|GAD93841.1| hypothetical protein AN5899.2 [Byssochlamys spec... 65 1e-08 gb|EAS29563.2| nuclear condensin complex subunit Smc2 [Coccidioi... 65 1e-08 dbj|GAA82366.1| condensin subunit [Aspergillus kawachii IFO 4308] 65 1e-08 gb|EHA22759.1| hypothetical protein ASPNIDRAFT_173999 [Aspergill... 65 1e-08 gb|EGE82428.1| nuclear condensin complex subunit Smc2 [Ajellomyc... 65 1e-08 gb|EGC42684.1| condensin subunit [Ajellomyces capsulatus H88] 65 1e-08 ref|XP_003065141.1| SMC proteins Flexible Hinge Domain containin... 65 1e-08 gb|EER42595.1| nuclear condensin complex subunit Smc2 [Ajellomyc... 65 1e-08 gb|EEQ85531.1| nuclear condensin complex subunit Smc2 [Ajellomyc... 65 1e-08 ref|XP_002622404.1| nuclear condensin complex subunit Smc2 [Ajel... 65 1e-08 ref|XP_002542750.1| structural maintenance of chromosome 2 [Unci... 65 1e-08 gb|EEH45094.1| conserved hypothetical protein [Paracoccidioides ... 65 1e-08 ref|XP_002791606.1| conserved hypothetical protein [Paracoccidio... 65 1e-08 gb|EEH20521.1| condensin subunit Cut14 [Paracoccidioides brasili... 65 1e-08 gb|EEH04059.1| condensin subunit [Ajellomyces capsulatus G186AR] 65 1e-08 ref|XP_002481050.1| nuclear condensin complex subunit Smc2, puta... 65 1e-08 ref|XP_002152031.1| nuclear condensin complex subunit Smc2, puta... 65 1e-08 ref|XP_001537520.1| hypothetical protein HCAG_07829 [Ajellomyces... 65 1e-08 ref|XP_001399441.1| structural maintenance of chromosomes protei... 65 1e-08 >ref|XP_755444.1| nuclear condensin complex subunit Smc2 [Aspergillus fumigatus Af293] gi|66853082|gb|EAL93406.1| nuclear condensin complex subunit Smc2, putative [Aspergillus fumigatus Af293] gi|159129514|gb|EDP54628.1| nuclear condensin complex subunit Smc2, putative [Aspergillus fumigatus A1163] Length = 1179 Score = 65.1 bits (157), Expect = 1e-08 Identities = 31/32 (96%), Positives = 31/32 (96%) Frame = -2 Query: 402 KDGMFQNANRIFRTRFSEGTSVVQALTPADFK 307 KDGMFQNANRIFRTRFSEGTSVVQALTPAD K Sbjct: 1148 KDGMFQNANRIFRTRFSEGTSVVQALTPADMK 1179 >dbj|GAD93841.1| hypothetical protein AN5899.2 [Byssochlamys spectabilis No. 5] Length = 1179 Score = 65.1 bits (157), Expect = 1e-08 Identities = 31/32 (96%), Positives = 31/32 (96%) Frame = -2 Query: 402 KDGMFQNANRIFRTRFSEGTSVVQALTPADFK 307 KDGMFQNANRIFRTRFSEGTSVVQALTPAD K Sbjct: 1148 KDGMFQNANRIFRTRFSEGTSVVQALTPADMK 1179 >gb|EAS29563.2| nuclear condensin complex subunit Smc2 [Coccidioides immitis RS] Length = 1179 Score = 65.1 bits (157), Expect = 1e-08 Identities = 31/32 (96%), Positives = 31/32 (96%) Frame = -2 Query: 402 KDGMFQNANRIFRTRFSEGTSVVQALTPADFK 307 KDGMFQNANRIFRTRFSEGTSVVQALTPAD K Sbjct: 1148 KDGMFQNANRIFRTRFSEGTSVVQALTPADLK 1179 >dbj|GAA82366.1| condensin subunit [Aspergillus kawachii IFO 4308] Length = 1179 Score = 65.1 bits (157), Expect = 1e-08 Identities = 31/32 (96%), Positives = 31/32 (96%) Frame = -2 Query: 402 KDGMFQNANRIFRTRFSEGTSVVQALTPADFK 307 KDGMFQNANRIFRTRFSEGTSVVQALTPAD K Sbjct: 1148 KDGMFQNANRIFRTRFSEGTSVVQALTPADMK 1179 >gb|EHA22759.1| hypothetical protein ASPNIDRAFT_173999 [Aspergillus niger ATCC 1015] Length = 1179 Score = 65.1 bits (157), Expect = 1e-08 Identities = 31/32 (96%), Positives = 31/32 (96%) Frame = -2 Query: 402 KDGMFQNANRIFRTRFSEGTSVVQALTPADFK 307 KDGMFQNANRIFRTRFSEGTSVVQALTPAD K Sbjct: 1148 KDGMFQNANRIFRTRFSEGTSVVQALTPADMK 1179 >gb|EGE82428.1| nuclear condensin complex subunit Smc2 [Ajellomyces dermatitidis ATCC 18188] Length = 1176 Score = 65.1 bits (157), Expect = 1e-08 Identities = 31/32 (96%), Positives = 31/32 (96%) Frame = -2 Query: 402 KDGMFQNANRIFRTRFSEGTSVVQALTPADFK 307 KDGMFQNANRIFRTRFSEGTSVVQALTPAD K Sbjct: 1145 KDGMFQNANRIFRTRFSEGTSVVQALTPADLK 1176 >gb|EGC42684.1| condensin subunit [Ajellomyces capsulatus H88] Length = 607 Score = 65.1 bits (157), Expect = 1e-08 Identities = 31/32 (96%), Positives = 31/32 (96%) Frame = -2 Query: 402 KDGMFQNANRIFRTRFSEGTSVVQALTPADFK 307 KDGMFQNANRIFRTRFSEGTSVVQALTPAD K Sbjct: 576 KDGMFQNANRIFRTRFSEGTSVVQALTPADLK 607 >ref|XP_003065141.1| SMC proteins Flexible Hinge Domain containing protein [Coccidioides posadasii C735 delta SOWgp] gi|240104801|gb|EER22996.1| SMC proteins Flexible Hinge Domain containing protein [Coccidioides posadasii C735 delta SOWgp] gi|320033964|gb|EFW15910.1| condensin subunit Cut14 [Coccidioides posadasii str. Silveira] Length = 1179 Score = 65.1 bits (157), Expect = 1e-08 Identities = 31/32 (96%), Positives = 31/32 (96%) Frame = -2 Query: 402 KDGMFQNANRIFRTRFSEGTSVVQALTPADFK 307 KDGMFQNANRIFRTRFSEGTSVVQALTPAD K Sbjct: 1148 KDGMFQNANRIFRTRFSEGTSVVQALTPADLK 1179 >gb|EER42595.1| nuclear condensin complex subunit Smc2 [Ajellomyces capsulatus H143] Length = 798 Score = 65.1 bits (157), Expect = 1e-08 Identities = 31/32 (96%), Positives = 31/32 (96%) Frame = -2 Query: 402 KDGMFQNANRIFRTRFSEGTSVVQALTPADFK 307 KDGMFQNANRIFRTRFSEGTSVVQALTPAD K Sbjct: 767 KDGMFQNANRIFRTRFSEGTSVVQALTPADLK 798 >gb|EEQ85531.1| nuclear condensin complex subunit Smc2 [Ajellomyces dermatitidis ER-3] Length = 1197 Score = 65.1 bits (157), Expect = 1e-08 Identities = 31/32 (96%), Positives = 31/32 (96%) Frame = -2 Query: 402 KDGMFQNANRIFRTRFSEGTSVVQALTPADFK 307 KDGMFQNANRIFRTRFSEGTSVVQALTPAD K Sbjct: 1166 KDGMFQNANRIFRTRFSEGTSVVQALTPADLK 1197 >ref|XP_002622404.1| nuclear condensin complex subunit Smc2 [Ajellomyces dermatitidis SLH14081] gi|239589720|gb|EEQ72363.1| nuclear condensin complex subunit Smc2 [Ajellomyces dermatitidis SLH14081] gi|531984447|gb|EQL35034.1| structural maintenance-chromosome 2 [Ajellomyces dermatitidis ATCC 26199] Length = 1179 Score = 65.1 bits (157), Expect = 1e-08 Identities = 31/32 (96%), Positives = 31/32 (96%) Frame = -2 Query: 402 KDGMFQNANRIFRTRFSEGTSVVQALTPADFK 307 KDGMFQNANRIFRTRFSEGTSVVQALTPAD K Sbjct: 1148 KDGMFQNANRIFRTRFSEGTSVVQALTPADLK 1179 >ref|XP_002542750.1| structural maintenance of chromosome 2 [Uncinocarpus reesii 1704] gi|237903016|gb|EEP77417.1| structural maintenance of chromosome 2 [Uncinocarpus reesii 1704] Length = 1179 Score = 65.1 bits (157), Expect = 1e-08 Identities = 31/32 (96%), Positives = 31/32 (96%) Frame = -2 Query: 402 KDGMFQNANRIFRTRFSEGTSVVQALTPADFK 307 KDGMFQNANRIFRTRFSEGTSVVQALTPAD K Sbjct: 1148 KDGMFQNANRIFRTRFSEGTSVVQALTPADLK 1179 >gb|EEH45094.1| conserved hypothetical protein [Paracoccidioides brasiliensis Pb18] Length = 1179 Score = 65.1 bits (157), Expect = 1e-08 Identities = 31/32 (96%), Positives = 31/32 (96%) Frame = -2 Query: 402 KDGMFQNANRIFRTRFSEGTSVVQALTPADFK 307 KDGMFQNANRIFRTRFSEGTSVVQALTPAD K Sbjct: 1148 KDGMFQNANRIFRTRFSEGTSVVQALTPADLK 1179 >ref|XP_002791606.1| conserved hypothetical protein [Paracoccidioides sp. 'lutzii' Pb01] gi|226279732|gb|EEH35298.1| conserved hypothetical protein [Paracoccidioides sp. 'lutzii' Pb01] Length = 1179 Score = 65.1 bits (157), Expect = 1e-08 Identities = 31/32 (96%), Positives = 31/32 (96%) Frame = -2 Query: 402 KDGMFQNANRIFRTRFSEGTSVVQALTPADFK 307 KDGMFQNANRIFRTRFSEGTSVVQALTPAD K Sbjct: 1148 KDGMFQNANRIFRTRFSEGTSVVQALTPADLK 1179 >gb|EEH20521.1| condensin subunit Cut14 [Paracoccidioides brasiliensis Pb03] Length = 1179 Score = 65.1 bits (157), Expect = 1e-08 Identities = 31/32 (96%), Positives = 31/32 (96%) Frame = -2 Query: 402 KDGMFQNANRIFRTRFSEGTSVVQALTPADFK 307 KDGMFQNANRIFRTRFSEGTSVVQALTPAD K Sbjct: 1148 KDGMFQNANRIFRTRFSEGTSVVQALTPADLK 1179 >gb|EEH04059.1| condensin subunit [Ajellomyces capsulatus G186AR] Length = 1192 Score = 65.1 bits (157), Expect = 1e-08 Identities = 31/32 (96%), Positives = 31/32 (96%) Frame = -2 Query: 402 KDGMFQNANRIFRTRFSEGTSVVQALTPADFK 307 KDGMFQNANRIFRTRFSEGTSVVQALTPAD K Sbjct: 1161 KDGMFQNANRIFRTRFSEGTSVVQALTPADLK 1192 >ref|XP_002481050.1| nuclear condensin complex subunit Smc2, putative [Talaromyces stipitatus ATCC 10500] gi|218721197|gb|EED20616.1| nuclear condensin complex subunit Smc2, putative [Talaromyces stipitatus ATCC 10500] Length = 1180 Score = 65.1 bits (157), Expect = 1e-08 Identities = 31/32 (96%), Positives = 31/32 (96%) Frame = -2 Query: 402 KDGMFQNANRIFRTRFSEGTSVVQALTPADFK 307 KDGMFQNANRIFRTRFSEGTSVVQALTPAD K Sbjct: 1149 KDGMFQNANRIFRTRFSEGTSVVQALTPADLK 1180 >ref|XP_002152031.1| nuclear condensin complex subunit Smc2, putative [Talaromyces marneffei ATCC 18224] gi|210066938|gb|EEA21031.1| nuclear condensin complex subunit Smc2, putative [Talaromyces marneffei ATCC 18224] Length = 1179 Score = 65.1 bits (157), Expect = 1e-08 Identities = 31/32 (96%), Positives = 31/32 (96%) Frame = -2 Query: 402 KDGMFQNANRIFRTRFSEGTSVVQALTPADFK 307 KDGMFQNANRIFRTRFSEGTSVVQALTPAD K Sbjct: 1148 KDGMFQNANRIFRTRFSEGTSVVQALTPADMK 1179 >ref|XP_001537520.1| hypothetical protein HCAG_07829 [Ajellomyces capsulatus NAm1] gi|150416032|gb|EDN11376.1| hypothetical protein HCAG_07829 [Ajellomyces capsulatus NAm1] Length = 1179 Score = 65.1 bits (157), Expect = 1e-08 Identities = 31/32 (96%), Positives = 31/32 (96%) Frame = -2 Query: 402 KDGMFQNANRIFRTRFSEGTSVVQALTPADFK 307 KDGMFQNANRIFRTRFSEGTSVVQALTPAD K Sbjct: 1148 KDGMFQNANRIFRTRFSEGTSVVQALTPADLK 1179 >ref|XP_001399441.1| structural maintenance of chromosomes protein 2 [Aspergillus niger CBS 513.88] gi|134056350|emb|CAK47585.1| unnamed protein product [Aspergillus niger] Length = 1179 Score = 65.1 bits (157), Expect = 1e-08 Identities = 31/32 (96%), Positives = 31/32 (96%) Frame = -2 Query: 402 KDGMFQNANRIFRTRFSEGTSVVQALTPADFK 307 KDGMFQNANRIFRTRFSEGTSVVQALTPAD K Sbjct: 1148 KDGMFQNANRIFRTRFSEGTSVVQALTPADMK 1179