BLASTX nr result
ID: Mentha25_contig00054865
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha25_contig00054865 (435 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EYU22630.1| hypothetical protein MIMGU_mgv1a021685mg, partial... 92 1e-16 ref|XP_006363176.1| PREDICTED: pentatricopeptide repeat-containi... 79 5e-13 ref|XP_007211368.1| hypothetical protein PRUPE_ppa002507mg [Prun... 79 9e-13 ref|XP_006468575.1| PREDICTED: pentatricopeptide repeat-containi... 78 1e-12 ref|XP_006448599.1| hypothetical protein CICLE_v10014519mg [Citr... 77 3e-12 ref|XP_002275605.1| PREDICTED: pentatricopeptide repeat-containi... 76 4e-12 emb|CBI27232.3| unnamed protein product [Vitis vinifera] 76 4e-12 ref|XP_004232626.1| PREDICTED: pentatricopeptide repeat-containi... 75 7e-12 ref|XP_006855880.1| hypothetical protein AMTR_s00037p00138240 [A... 72 6e-11 ref|XP_002528143.1| pentatricopeptide repeat-containing protein,... 72 8e-11 ref|XP_002297917.1| hypothetical protein POPTR_0001s12190g [Popu... 72 1e-10 ref|XP_002304600.2| hypothetical protein POPTR_0003s15360g [Popu... 70 4e-10 ref|XP_007138861.1| hypothetical protein PHAVU_009G243700g [Phas... 69 5e-10 ref|XP_004295517.1| PREDICTED: pentatricopeptide repeat-containi... 69 9e-10 ref|XP_003534864.1| PREDICTED: pentatricopeptide repeat-containi... 68 1e-09 gb|EXB83265.1| hypothetical protein L484_011559 [Morus notabilis] 67 3e-09 ref|XP_007040996.1| Pentatricopeptide repeat (PPR) superfamily p... 65 8e-09 ref|XP_006283284.1| hypothetical protein CARUB_v10004320mg [Caps... 65 8e-09 ref|XP_004487899.1| PREDICTED: pentatricopeptide repeat-containi... 64 2e-08 ref|XP_003594857.1| Pentatricopeptide repeat-containing protein ... 63 5e-08 >gb|EYU22630.1| hypothetical protein MIMGU_mgv1a021685mg, partial [Mimulus guttatus] Length = 590 Score = 91.7 bits (226), Expect = 1e-16 Identities = 44/61 (72%), Positives = 51/61 (83%) Frame = +1 Query: 253 KLGSYTRGDSTFYSLIQHHAHAGDFRSLEAIFQRMKRENRAFSEKIFILVFQA*GKARFN 432 KLGSY RGDSTFYSLI+HHA++GDFR+LE +FQRMKRE R F EK FILVF+A K R + Sbjct: 14 KLGSYRRGDSTFYSLIEHHANSGDFRALEIVFQRMKRERRVFIEKNFILVFRACAKFRLH 73 Query: 433 R 435 R Sbjct: 74 R 74 >ref|XP_006363176.1| PREDICTED: pentatricopeptide repeat-containing protein At4g20090-like isoform X1 [Solanum tuberosum] gi|565395083|ref|XP_006363177.1| PREDICTED: pentatricopeptide repeat-containing protein At4g20090-like isoform X2 [Solanum tuberosum] Length = 717 Score = 79.3 bits (194), Expect = 5e-13 Identities = 40/60 (66%), Positives = 47/60 (78%) Frame = +1 Query: 247 AQKLGSYTRGDSTFYSLIQHHAHAGDFRSLEAIFQRMKRENRAFSEKIFILVFQA*GKAR 426 A KLGS+ GDSTFYSLI+ +A++GDF SLE +F RMK E R F EK FILVF+A GKAR Sbjct: 128 APKLGSFKLGDSTFYSLIEKYANSGDFTSLEKVFDRMKCEKRVFIEKSFILVFRAYGKAR 187 >ref|XP_007211368.1| hypothetical protein PRUPE_ppa002507mg [Prunus persica] gi|462407233|gb|EMJ12567.1| hypothetical protein PRUPE_ppa002507mg [Prunus persica] Length = 664 Score = 78.6 bits (192), Expect = 9e-13 Identities = 38/57 (66%), Positives = 46/57 (80%) Frame = +1 Query: 253 KLGSYTRGDSTFYSLIQHHAHAGDFRSLEAIFQRMKRENRAFSEKIFILVFQA*GKA 423 KLGSY GDSTFYSLI+++A+ GDFRSLE + RMKRE R F E+ FIL+F+A GKA Sbjct: 77 KLGSYKSGDSTFYSLIENYANLGDFRSLEQVLDRMKRERRVFIEQSFILMFRAYGKA 133 >ref|XP_006468575.1| PREDICTED: pentatricopeptide repeat-containing protein At4g20090-like [Citrus sinensis] Length = 664 Score = 78.2 bits (191), Expect = 1e-12 Identities = 37/57 (64%), Positives = 45/57 (78%) Frame = +1 Query: 253 KLGSYTRGDSTFYSLIQHHAHAGDFRSLEAIFQRMKRENRAFSEKIFILVFQA*GKA 423 KLGSY GDSTFYSLIQH+A++GDF+SLE + RM+RE R EK FI +F+A GKA Sbjct: 75 KLGSYQLGDSTFYSLIQHYANSGDFKSLEMVLYRMRREKRVVLEKSFIFIFKAYGKA 131 >ref|XP_006448599.1| hypothetical protein CICLE_v10014519mg [Citrus clementina] gi|557551210|gb|ESR61839.1| hypothetical protein CICLE_v10014519mg [Citrus clementina] Length = 664 Score = 77.0 bits (188), Expect = 3e-12 Identities = 37/57 (64%), Positives = 45/57 (78%) Frame = +1 Query: 253 KLGSYTRGDSTFYSLIQHHAHAGDFRSLEAIFQRMKRENRAFSEKIFILVFQA*GKA 423 KLGSY GDSTFYSLIQH+A++GDF+SLE + RM+RE R EK FI +F+A GKA Sbjct: 75 KLGSYQLGDSTFYSLIQHYANSGDFKSLEMVLCRMRREKRVALEKSFIFIFKAYGKA 131 >ref|XP_002275605.1| PREDICTED: pentatricopeptide repeat-containing protein At4g20090-like [Vitis vinifera] Length = 644 Score = 76.3 bits (186), Expect = 4e-12 Identities = 37/59 (62%), Positives = 47/59 (79%) Frame = +1 Query: 247 AQKLGSYTRGDSTFYSLIQHHAHAGDFRSLEAIFQRMKRENRAFSEKIFILVFQA*GKA 423 A ++GSY GDSTFYSLI+++A++GDF +L +F RMKRE R F EK FILVF+A GKA Sbjct: 54 ASQMGSYKSGDSTFYSLIENYANSGDFGTLFQVFDRMKRERRVFIEKNFILVFRAYGKA 112 >emb|CBI27232.3| unnamed protein product [Vitis vinifera] Length = 660 Score = 76.3 bits (186), Expect = 4e-12 Identities = 37/59 (62%), Positives = 47/59 (79%) Frame = +1 Query: 247 AQKLGSYTRGDSTFYSLIQHHAHAGDFRSLEAIFQRMKRENRAFSEKIFILVFQA*GKA 423 A ++GSY GDSTFYSLI+++A++GDF +L +F RMKRE R F EK FILVF+A GKA Sbjct: 70 ASQMGSYKSGDSTFYSLIENYANSGDFGTLFQVFDRMKRERRVFIEKNFILVFRAYGKA 128 >ref|XP_004232626.1| PREDICTED: pentatricopeptide repeat-containing protein At4g20090-like [Solanum lycopersicum] Length = 717 Score = 75.5 bits (184), Expect = 7e-12 Identities = 39/60 (65%), Positives = 46/60 (76%) Frame = +1 Query: 247 AQKLGSYTRGDSTFYSLIQHHAHAGDFRSLEAIFQRMKRENRAFSEKIFILVFQA*GKAR 426 A KLGS+ GDSTFYSLI+ +A++ DF SLE +F RMK E R F EK FILVF+A GKAR Sbjct: 128 APKLGSFKLGDSTFYSLIEKYANSEDFTSLEKVFGRMKCEKRVFIEKSFILVFRAYGKAR 187 >ref|XP_006855880.1| hypothetical protein AMTR_s00037p00138240 [Amborella trichopoda] gi|548859701|gb|ERN17347.1| hypothetical protein AMTR_s00037p00138240 [Amborella trichopoda] Length = 649 Score = 72.4 bits (176), Expect = 6e-11 Identities = 34/59 (57%), Positives = 45/59 (76%) Frame = +1 Query: 247 AQKLGSYTRGDSTFYSLIQHHAHAGDFRSLEAIFQRMKRENRAFSEKIFILVFQA*GKA 423 A +G Y +GDSTF+SL+Q +A +GDF L +F RMKRENR F+EK+FILV +A G+A Sbjct: 62 APTMGPYKQGDSTFFSLVQTYADSGDFVLLNQVFTRMKRENRVFTEKLFILVIKAHGRA 120 >ref|XP_002528143.1| pentatricopeptide repeat-containing protein, putative [Ricinus communis] gi|223532441|gb|EEF34234.1| pentatricopeptide repeat-containing protein, putative [Ricinus communis] Length = 653 Score = 72.0 bits (175), Expect = 8e-11 Identities = 33/57 (57%), Positives = 45/57 (78%) Frame = +1 Query: 253 KLGSYTRGDSTFYSLIQHHAHAGDFRSLEAIFQRMKRENRAFSEKIFILVFQA*GKA 423 K+GS+ GDSTFYSLI+++A++ DF SLE + RM+ ENR FSEK F ++F+A GKA Sbjct: 64 KMGSFKVGDSTFYSLIENYAYSSDFNSLEKVLNRMRLENRVFSEKSFFVMFKAYGKA 120 >ref|XP_002297917.1| hypothetical protein POPTR_0001s12190g [Populus trichocarpa] gi|222845175|gb|EEE82722.1| hypothetical protein POPTR_0001s12190g [Populus trichocarpa] Length = 670 Score = 71.6 bits (174), Expect = 1e-10 Identities = 34/57 (59%), Positives = 43/57 (75%) Frame = +1 Query: 253 KLGSYTRGDSTFYSLIQHHAHAGDFRSLEAIFQRMKRENRAFSEKIFILVFQA*GKA 423 K+GSY GDSTFYSLI ++A+ GDF+SLE + RMK E R EK FI++F+A GKA Sbjct: 82 KMGSYRLGDSTFYSLINNYANLGDFKSLEKVLDRMKCEKRVIFEKCFIVIFKAYGKA 138 >ref|XP_002304600.2| hypothetical protein POPTR_0003s15360g [Populus trichocarpa] gi|550343237|gb|EEE79579.2| hypothetical protein POPTR_0003s15360g [Populus trichocarpa] Length = 672 Score = 69.7 bits (169), Expect = 4e-10 Identities = 32/57 (56%), Positives = 43/57 (75%) Frame = +1 Query: 253 KLGSYTRGDSTFYSLIQHHAHAGDFRSLEAIFQRMKRENRAFSEKIFILVFQA*GKA 423 K+GSY GDSTFYSLI ++A+ GDF+SLE + RM+ E R EK F+++F+A GKA Sbjct: 83 KMGSYKLGDSTFYSLIDNYANLGDFKSLEKVLDRMRCEKRVVVEKCFVVIFKAYGKA 139 >ref|XP_007138861.1| hypothetical protein PHAVU_009G243700g [Phaseolus vulgaris] gi|561011948|gb|ESW10855.1| hypothetical protein PHAVU_009G243700g [Phaseolus vulgaris] Length = 645 Score = 69.3 bits (168), Expect = 5e-10 Identities = 34/57 (59%), Positives = 43/57 (75%) Frame = +1 Query: 253 KLGSYTRGDSTFYSLIQHHAHAGDFRSLEAIFQRMKRENRAFSEKIFILVFQA*GKA 423 K+GSY GD +FYSLIQ+HA DF SLE + Q+MKRE R F E+ FI++F+A GKA Sbjct: 56 KMGSYKLGDLSFYSLIQNHASTLDFGSLEEVLQQMKRERRVFVERNFIVMFKAYGKA 112 >ref|XP_004295517.1| PREDICTED: pentatricopeptide repeat-containing protein At4g20090-like [Fragaria vesca subsp. vesca] Length = 647 Score = 68.6 bits (166), Expect = 9e-10 Identities = 34/55 (61%), Positives = 40/55 (72%) Frame = +1 Query: 259 GSYTRGDSTFYSLIQHHAHAGDFRSLEAIFQRMKRENRAFSEKIFILVFQA*GKA 423 G+Y GDSTFYSLI+++A GDF SLE + RMKRE R F E FI VF+A GKA Sbjct: 60 GAYKSGDSTFYSLIENYASLGDFGSLEKVLDRMKRERRVFVEGSFIAVFRAFGKA 114 >ref|XP_003534864.1| PREDICTED: pentatricopeptide repeat-containing protein At4g20090-like isoform X1 [Glycine max] gi|571476386|ref|XP_006586943.1| PREDICTED: pentatricopeptide repeat-containing protein At4g20090-like isoform X2 [Glycine max] gi|571476388|ref|XP_006586944.1| PREDICTED: pentatricopeptide repeat-containing protein At4g20090-like isoform X3 [Glycine max] gi|571476390|ref|XP_006586945.1| PREDICTED: pentatricopeptide repeat-containing protein At4g20090-like isoform X4 [Glycine max] gi|571476393|ref|XP_006586946.1| PREDICTED: pentatricopeptide repeat-containing protein At4g20090-like isoform X5 [Glycine max] gi|571476395|ref|XP_006586947.1| PREDICTED: pentatricopeptide repeat-containing protein At4g20090-like isoform X6 [Glycine max] Length = 642 Score = 68.2 bits (165), Expect = 1e-09 Identities = 33/57 (57%), Positives = 43/57 (75%) Frame = +1 Query: 253 KLGSYTRGDSTFYSLIQHHAHAGDFRSLEAIFQRMKRENRAFSEKIFILVFQA*GKA 423 ++GSY GD +FYSLI+ HA + DFRSLE + +MKRE R F EK FI++F+A GKA Sbjct: 53 QMGSYKLGDLSFYSLIESHASSLDFRSLEEVLHQMKRERRVFLEKNFIVMFKAYGKA 109 >gb|EXB83265.1| hypothetical protein L484_011559 [Morus notabilis] Length = 699 Score = 67.0 bits (162), Expect = 3e-09 Identities = 32/55 (58%), Positives = 40/55 (72%) Frame = +1 Query: 259 GSYTRGDSTFYSLIQHHAHAGDFRSLEAIFQRMKRENRAFSEKIFILVFQA*GKA 423 GSY GDSTFYSLI ++A + DFRSLE + R+K E R EK FI++F+A GKA Sbjct: 61 GSYKLGDSTFYSLIHNYASSADFRSLEKVLDRIKSERRVLVEKCFIVIFRAYGKA 115 >ref|XP_007040996.1| Pentatricopeptide repeat (PPR) superfamily protein [Theobroma cacao] gi|508704931|gb|EOX96827.1| Pentatricopeptide repeat (PPR) superfamily protein [Theobroma cacao] Length = 636 Score = 65.5 bits (158), Expect = 8e-09 Identities = 32/59 (54%), Positives = 41/59 (69%) Frame = +1 Query: 247 AQKLGSYTRGDSTFYSLIQHHAHAGDFRSLEAIFQRMKRENRAFSEKIFILVFQA*GKA 423 A + GS+ GDST YSLI H+AH DF SL + RMK +NR F EK F+L+F+A G+A Sbjct: 45 APQSGSFRLGDSTCYSLIHHYAHKVDFASLHDVLCRMKLQNRVFIEKYFLLIFKAYGRA 103 >ref|XP_006283284.1| hypothetical protein CARUB_v10004320mg [Capsella rubella] gi|482551989|gb|EOA16182.1| hypothetical protein CARUB_v10004320mg [Capsella rubella] Length = 660 Score = 65.5 bits (158), Expect = 8e-09 Identities = 31/59 (52%), Positives = 44/59 (74%) Frame = +1 Query: 247 AQKLGSYTRGDSTFYSLIQHHAHAGDFRSLEAIFQRMKRENRAFSEKIFILVFQA*GKA 423 A K+GSY GDST S+I+++A++GDF S+E + R++ ENR SE FI+VF+A GKA Sbjct: 67 APKMGSYKLGDSTLSSMIENYANSGDFASVEQVLSRVRLENRVISEHSFIVVFRAYGKA 125 >ref|XP_004487899.1| PREDICTED: pentatricopeptide repeat-containing protein At4g20090-like isoform X1 [Cicer arietinum] Length = 649 Score = 63.9 bits (154), Expect = 2e-08 Identities = 32/55 (58%), Positives = 41/55 (74%) Frame = +1 Query: 259 GSYTRGDSTFYSLIQHHAHAGDFRSLEAIFQRMKRENRAFSEKIFILVFQA*GKA 423 GSY GD +FYSLI++ + + DF SLE + +MKRENR F EK FIL+F+A GKA Sbjct: 62 GSYKLGDLSFYSLIENFSASSDFVSLEHLLHQMKRENRVFIEKNFILMFKAYGKA 116 >ref|XP_003594857.1| Pentatricopeptide repeat-containing protein [Medicago truncatula] gi|355483905|gb|AES65108.1| Pentatricopeptide repeat-containing protein [Medicago truncatula] Length = 647 Score = 62.8 bits (151), Expect = 5e-08 Identities = 31/59 (52%), Positives = 43/59 (72%) Frame = +1 Query: 247 AQKLGSYTRGDSTFYSLIQHHAHAGDFRSLEAIFQRMKRENRAFSEKIFILVFQA*GKA 423 + K GSY GD +FYSLI++ +++ DF SLE + +MK ENR F EK FI++F+A GKA Sbjct: 55 SHKWGSYKLGDLSFYSLIENFSNSLDFTSLEQLLHQMKCENRVFIEKSFIIMFKAYGKA 113