BLASTX nr result
ID: Mentha25_contig00054697
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha25_contig00054697 (373 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_001211071.1| predicted protein [Aspergillus terreus NIH26... 55 8e-06 ref|XP_001216587.1| predicted protein [Aspergillus terreus NIH26... 55 8e-06 >ref|XP_001211071.1| predicted protein [Aspergillus terreus NIH2624] gi|114195155|gb|EAU36855.1| predicted protein [Aspergillus terreus NIH2624] Length = 1292 Score = 55.5 bits (132), Expect = 8e-06 Identities = 25/55 (45%), Positives = 41/55 (74%) Frame = -2 Query: 372 IYQHWLREKLQSLDENNLKLTWVPTSQMPADG*TKRLHIFKHQESVRMVGLDDTS 208 I++HWLR+++Q+ ++++ WVPT+QM ADG TKRL KHQE ++ + ++D S Sbjct: 1237 IHRHWLRQEVQN---GSIQIQWVPTNQMIADGLTKRLTYQKHQEFMKHLNMEDIS 1288 >ref|XP_001216587.1| predicted protein [Aspergillus terreus NIH2624] gi|114189439|gb|EAU31139.1| predicted protein [Aspergillus terreus NIH2624] Length = 1407 Score = 55.5 bits (132), Expect = 8e-06 Identities = 25/55 (45%), Positives = 41/55 (74%) Frame = -2 Query: 372 IYQHWLREKLQSLDENNLKLTWVPTSQMPADG*TKRLHIFKHQESVRMVGLDDTS 208 I++HWLR+++Q+ ++++ WVPT+QM ADG TKRL KHQE ++ + ++D S Sbjct: 1352 IHRHWLRQEVQN---GSIQIQWVPTNQMIADGLTKRLTYQKHQEFMKHLNMEDIS 1403