BLASTX nr result
ID: Mentha25_contig00054553
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha25_contig00054553 (428 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EPE32369.1| Prefoldin [Glarea lozoyensis ATCC 20868] 62 6e-08 gb|ELR08032.1| hypothetical protein GMDG_02870 [Pseudogymnoascus... 56 6e-06 gb|ENH82890.1| prefoldin subunit 1 [Colletotrichum orbiculare MA... 55 1e-05 >gb|EPE32369.1| Prefoldin [Glarea lozoyensis ATCC 20868] Length = 121 Score = 62.4 bits (150), Expect = 6e-08 Identities = 28/36 (77%), Positives = 33/36 (91%) Frame = +1 Query: 1 DLELEVENLGKKLQYLETTYKNSRDHIDQILKSGSR 108 +L+ +VENLGKKLQYLETTYKNSR+HIDQI K+G R Sbjct: 85 ELKSDVENLGKKLQYLETTYKNSREHIDQIFKNGGR 120 >gb|ELR08032.1| hypothetical protein GMDG_02870 [Pseudogymnoascus destructans 20631-21] Length = 121 Score = 55.8 bits (133), Expect = 6e-06 Identities = 25/36 (69%), Positives = 31/36 (86%) Frame = +1 Query: 4 LELEVENLGKKLQYLETTYKNSRDHIDQILKSGSRA 111 L+ +VE+L KKL YLETTYKNSR+H++QI KSG RA Sbjct: 86 LKTDVESLNKKLHYLETTYKNSREHMEQIFKSGGRA 121 >gb|ENH82890.1| prefoldin subunit 1 [Colletotrichum orbiculare MAFF 240422] Length = 80 Score = 55.1 bits (131), Expect = 1e-05 Identities = 25/33 (75%), Positives = 30/33 (90%) Frame = +1 Query: 7 ELEVENLGKKLQYLETTYKNSRDHIDQILKSGS 105 E+EVENLG+KL YLETT+KNSR HIDQ+LK+ S Sbjct: 48 EVEVENLGQKLHYLETTFKNSRQHIDQMLKAQS 80