BLASTX nr result
ID: Mentha25_contig00054304
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha25_contig00054304 (382 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value emb|CCU82264.1| U3 snoRNP protein [Blumeria graminis f. sp. hord... 70 4e-10 gb|EPQ66232.1| Nucleolar protein component of the small subunit ... 65 1e-08 gb|ESZ95404.1| hypothetical protein SBOR_4199 [Sclerotinia borea... 57 2e-06 ref|XP_007290887.1| hypothetical protein MBM_02998 [Marssonina b... 57 2e-06 ref|XP_001546317.1| hypothetical protein BC1G_15255 [Botryotinia... 55 8e-06 >emb|CCU82264.1| U3 snoRNP protein [Blumeria graminis f. sp. hordei DH14] Length = 407 Score = 69.7 bits (169), Expect = 4e-10 Identities = 32/59 (54%), Positives = 44/59 (74%) Frame = -1 Query: 382 PEFPPALGLSLQRFTESFEKVEDKNQYSELSRAWMTQVLSSENLDTAIKTVLEHKLRIL 206 PEFP ALG SL R TES E V D+ YS+L+R W+ Q L+ ++LD+AI+TV++H LR + Sbjct: 340 PEFPAALGTSLHRITESMEIVSDRANYSKLTRIWLEQTLALDDLDSAIQTVIKHTLRTI 398 >gb|EPQ66232.1| Nucleolar protein component of the small subunit (SSU) processome [Blumeria graminis f. sp. tritici 96224] Length = 407 Score = 64.7 bits (156), Expect = 1e-08 Identities = 30/56 (53%), Positives = 40/56 (71%) Frame = -1 Query: 382 PEFPPALGLSLQRFTESFEKVEDKNQYSELSRAWMTQVLSSENLDTAIKTVLEHKL 215 PEFP AL SL R TES E V DK YS+L++ W+ Q L+ ++LD AI+TV++H L Sbjct: 340 PEFPAALSTSLHRITESIEIVSDKANYSKLTKVWLEQTLALDDLDCAIQTVIKHTL 395 >gb|ESZ95404.1| hypothetical protein SBOR_4199 [Sclerotinia borealis F-4157] Length = 400 Score = 57.4 bits (137), Expect = 2e-06 Identities = 28/59 (47%), Positives = 38/59 (64%) Frame = -1 Query: 382 PEFPPALGLSLQRFTESFEKVEDKNQYSELSRAWMTQVLSSENLDTAIKTVLEHKLRIL 206 PEF A+G SL R ES E DK Q S ++AW+ +L+ +LD+ I+TVL+H LR L Sbjct: 341 PEFAMAIGSSLNRLKESMENTNDKTQLSLKTKAWLEAILALPDLDSGIQTVLQHTLRKL 399 >ref|XP_007290887.1| hypothetical protein MBM_02998 [Marssonina brunnea f. sp. 'multigermtubi' MB_m1] gi|406865715|gb|EKD18756.1| hypothetical protein MBM_02998 [Marssonina brunnea f. sp. 'multigermtubi' MB_m1] Length = 427 Score = 57.4 bits (137), Expect = 2e-06 Identities = 29/57 (50%), Positives = 36/57 (63%) Frame = -1 Query: 376 FPPALGLSLQRFTESFEKVEDKNQYSELSRAWMTQVLSSENLDTAIKTVLEHKLRIL 206 FP ALG L R ES EK DK + + +RAW+ +L+ E LD IKTVLEH +R L Sbjct: 366 FPMALGSFLDRLKESMEKTNDKTELVKKTRAWIEPILALEELDPDIKTVLEHTMRKL 422 >ref|XP_001546317.1| hypothetical protein BC1G_15255 [Botryotinia fuckeliana B05.10] gi|347827616|emb|CCD43313.1| similar to rRNA processing protein Utp6 [Botryotinia fuckeliana T4] gi|472237307|gb|EMR82209.1| putative rrna processing protein utp6 protein [Botryotinia fuckeliana BcDW1] Length = 400 Score = 55.5 bits (132), Expect = 8e-06 Identities = 27/59 (45%), Positives = 37/59 (62%) Frame = -1 Query: 382 PEFPPALGLSLQRFTESFEKVEDKNQYSELSRAWMTQVLSSENLDTAIKTVLEHKLRIL 206 PEF A+G +L R ES E DK Q S +RAW+ +++ LD+ I+TVL+H LR L Sbjct: 341 PEFAVAIGSALNRLKESMENTNDKTQLSLKTRAWIEAIVALPELDSGIQTVLQHTLRKL 399