BLASTX nr result
ID: Mentha25_contig00053985
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha25_contig00053985 (501 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_007015750.1| F-box and associated interaction domains-con... 63 5e-08 >ref|XP_007015750.1| F-box and associated interaction domains-containing protein, putative isoform 1 [Theobroma cacao] gi|590586605|ref|XP_007015751.1| F-box and associated interaction domains-containing protein, putative isoform 1 [Theobroma cacao] gi|508786113|gb|EOY33369.1| F-box and associated interaction domains-containing protein, putative isoform 1 [Theobroma cacao] gi|508786114|gb|EOY33370.1| F-box and associated interaction domains-containing protein, putative isoform 1 [Theobroma cacao] Length = 387 Score = 62.8 bits (151), Expect = 5e-08 Identities = 51/163 (31%), Positives = 80/163 (49%), Gaps = 3/163 (1%) Frame = +2 Query: 2 SQSNDYKLVRSVSNYFHEYYNANGSPGFTHVLDRQIELYSLKTNTWKVIDSPPHKLLLGS 181 S ++DYK+VR V+NYF E G + H Q+ELYSLK+++WK I S P S Sbjct: 162 SITDDYKVVRFVTNYFDENEEEGGLADWIH----QVELYSLKSDSWKEI-SVPEAHPYAS 216 Query: 182 GVYVNNTSKCYWVQHSPFES--VIAFDFEKETLSSCIRMP-PSFITSSDLDCDDPDVFDG 352 ++ N + Y+ Q + +++FD E S+ +P P+F S Sbjct: 217 PLFNNYVNGSYYWQATGNSDYLILSFDMANEKFST---LPLPTFGGSL--------AQYY 265 Query: 353 LSIFEYMGSLAAIGYKKSGFHTLYEAWILKEEEQDWEQEFSIE 481 L + ++ GSL AI Y + G + W++ W ++FSIE Sbjct: 266 LQLLDFNGSLGAIVYPREGTEKSIDLWVM---NGSWTRQFSIE 305