BLASTX nr result
ID: Mentha25_contig00053964
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha25_contig00053964 (785 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|ABW72074.1| TE3 [Blumeria graminis f. sp. hordei] 78 4e-12 >gb|ABW72074.1| TE3 [Blumeria graminis f. sp. hordei] Length = 1224 Score = 77.8 bits (190), Expect = 4e-12 Identities = 40/112 (35%), Positives = 62/112 (55%), Gaps = 2/112 (1%) Frame = -2 Query: 334 LFVSGTRKVEWLNTWRDTRAYESNNQYAPLQVLMSSLRSVAGNRVQQPNLALAATLPTGE 155 +FV GT +V+WL+ WR+ RAY +YA L+ +MS+LR R + N + A++ Sbjct: 1 MFVEGTMEVKWLSNWREIRAYTDGKKYARLEDMMSTLRVAVEQRSLRSN-PVVASVSNNS 59 Query: 154 DLDP--NEYCKLCRHRHKNRYCFRLHPELASXXXXXXXXXXXKAAMEYESQD 5 ++P ++ C+ CRH+H N+ CF+ HPEL K A + ES D Sbjct: 60 RMEPGLDDPCRRCRHKHLNKDCFKQHPELRQYRKVQDKKGKAKTACQEESSD 111