BLASTX nr result
ID: Mentha25_contig00053926
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha25_contig00053926 (802 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002511933.1| conserved hypothetical protein [Ricinus comm... 59 2e-06 >ref|XP_002511933.1| conserved hypothetical protein [Ricinus communis] gi|223549113|gb|EEF50602.1| conserved hypothetical protein [Ricinus communis] Length = 214 Score = 58.9 bits (141), Expect = 2e-06 Identities = 47/175 (26%), Positives = 77/175 (44%), Gaps = 16/175 (9%) Frame = -2 Query: 741 FRFEVSSSPANLVNADEIFSEGQIMAVYSRTTXXXXXXXXXXXPF---------LRAGGR 589 F +S P LV+AD++FS+G I V+ + P + + G Sbjct: 65 FDVPISEHPERLVHADQLFSDGLIKPVFVNQSKIEASDPLDLVPIPCSSFSSRNVVSTGH 124 Query: 588 SPCCVLRRWTK----IVRKCLGFVN---RSVGLSRKSIRVDDLQRKVLELRSFDASPRRS 430 C +L+RW K I+RKC G++ + +RK RVDD+ + +++S+ + P+ S Sbjct: 125 IQCHILKRWKKSSERILRKCFGYLKPLCHKITGARKCTRVDDIDERARQVKSWSSLPQAS 184 Query: 429 SELMDNFEYGFEFVKMEKNYWRILPCPNRSTSYVCCDADENSIREAILYCKRSIE 265 + N W CD E+SI EA+L+CKRS++ Sbjct: 185 PHRI-----------YSTNSW--------------CDI-ESSIYEAVLHCKRSVD 213